Conserved Protein Domain Family
NPF

?
pfam16601: NPF 
Rabosyn-5 repeating NPF sequence-motif
NPF is a natively unstructured but well-conserved region found in eukaryotic proteins of the Rabenosyn-5 type, wherein the sequence motif arginine-proline-phenylalanine followed by several glutamates and aspartates is repeated up to four times along the sequence. NPF lies between the two Rab-binding domains, for Rab-4 and Rab-5, at the C-terminal end of these proteins. Rabosyn-5 (or rabenosyn) is also involved in cell-polarity determination in developing wing epithelia of Drosophila, when the NPF-motif may be implicated. These NPF motifs create a region of strong positive surface potential which appear to bind Eps15 homology, EH or EF-hand, domains on proteins involved in vesicle trafficking.
Statistics
?
PSSM-Id: 318744
View PSSM: pfam16601
Aligned: 16 rows
Threshold Bit Score: 168.835
Threshold Setting Gi: 551500378
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 327266073 549 SLDFREAKHSTVETGKERTNQIAQALDLDTTQNRSNPGSKTPLPCGGGKaPTRDSPIFPAQLQRIPQHDGVTGQNVTVPL 628
gi 947306229 548 SLDFREVSPFQLEPSREPRGHLAYALDLGPSPARGDVASHNPSPGSAAE-PIRVWAGRLALGQEHFPQSSVSQQNEVSSL 626
gi 291393490 548 SLDFREIGPFQLEPSREPRPHLAYALDLGPSSGQSSTAPTTSSPSPAQE-PNLVWAGPSACGQECPPQGPVSQPNEVPSL 626
gi 126336451 545 SLDFKD-KLFHWESGIDSPSQTAHILDLGPSLVRHNAVLKSPSPSSGQE-PNKEKPVFSTIAQEIL------QQNEVVSL 616
gi 831236831 548 SLDFREIRPFQLQAGREPRTHLAYALDLGSSPVQSSTAPKTPSPCSAQE-PVQIWSGPPVLGQEFLPQSSISQQDEVPSL 626
gi 354465511 544 ALDLRDVVPFQLDPNRGPHSDLAYALDQDFSPVQGSTAPNTLSPGSTLA-PIHLWSGPPALGQELLLQNTMSQQSDKTSL 622
gi 861500873 429 ALDSREAAPFLLEPSRGPRPHPAFALELGSSSGSG-MAPETPSPCAV-------W----ALSQESLHQSTEPQQNDC-AL 495
gi 483521926 498 SLDFREVKQHQHEVTKENQNLIAHGLDLDSTQMKGNPGSET---TAVQQlPAKDNFIFPVKPQNVPQH--DKDQNRAACL 572
gi 513205908 439 SLDFREGKQHQYEAAKENQNLLAHGLDLDITQVKGNRSFET---TAVQQlPAKEYLIFPVRHQNTPRC--DKDQNQAACL 513
gi 355786364 512 SLDFREIGPFQLEPSREPRTHLAYALDLGSSPVPSSTGPKTPSPSSTQQ-PTRVWSGPPALGQELLTQSSMPQQHEGPSL 590
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 327266073 629 NPFENEEVVTSLKM-EPDNPFAeDPSPV---TPLPIQvlhsskKEYNPFEDEDFHQA-N----------GAAVSAPNPFE 693
gi 947306229 627 NPFDEDELPSPLDA-GPTSPPA-EASFG---LSTRVP------REYNPFEEEEEEVPgNpf-------tDPDSPPPNPFD 688
gi 291393490 627 NPFEEEDLASPREE-DPTHPPTaEVSVS---PAAPVP------KEYNPFEEEEEEVV-Agnp-----ftSPDSPAPNPFE 690
gi 126336451 617 NPFEEEEVSSPGDE-GLTNPFAeDVSHGgcsPPSAVAsv---kKEYNPFEDEEDEPV-G----------DANGPLLNPFE 681
gi 831236831 627 NPFDEEDFSSPTEE-ATASAPAtELSSG---PSAYIP------KVYNPFEEEEEEEA-Aaen----pftHPDSPVPNPFD 691
gi 354465511 623 NPFD-EDLSSPAE--GATSPAAaEAFLG---PSAPVT------REYNPFEEDAEEEE-AgesgagnpftDPNSPAPNPFD 689
gi 861500873 496 NSFSRDFFSSPAVV-QAKLP-----------------------REYNPFEEEEEEEE-Eavaag-npftSPDSPAPNPFD 549
gi 483521926 573 NPFE-DETDTPLSEeDPANPFAkDISPLisfSNAIVQsd---kKEYNPFENEEDEQT-N----------GASVSTSNPFE 637
gi 513205908 514 NPFE-DDADTPLSEeDPTNPFAkDVSQPisfSNTALQsd---kKEYNPFENEEEGEQ-Ts---------GASVSTLNPFE 579
gi 355786364 591 NPFDEEDLSSPMEE-GTTSPPAaGVSFD---PSARML------KEYNPFEEEDEEEE-Avagn---pfiQPDSPAPNPFN 656
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 327266073 694 DAAGNPFHS--------PVSRQESGNPFEESPssSMNPFEVddDDDNE 733
gi 947306229 689 EEEEHPHQS--------PSSPPVPGNPFVKAV--CTNPFET--DSDSG 724
gi 291393490 691 EEEESPHLR--------PSSPPVPGNPFEEPA--GPNPFEV--DSDSG 726
gi 126336451 682 EDEQLPYPK--------HSSPPHPGNPFEEPA--STNPFDM--E-DSE 716
gi 831236831 692 EEDEHPHPR--------SSSPLVPGNPFEEPT--CTNPFEV--DSDSG 727
gi 354465511 690 ED---DHPR--------PASPPAPGNPFEECP--CTNPFEV--DSDSG 722
gi 861500873 550 SPAPNPFEDgndvpnrsPASPPVPGNPFEEPT--GTNPFEV--DSDSC 593
gi 483521926 638 E-DENPCQK--------SGG--NSGNPFEEGS--STNPFEV--EDGNE 670
gi 513205908 580 E-DENPFQK--------SGSNWNSGNPFEESS--STNPFEV--EDVSE 614
gi 355786364 657 EEDEHPQQR--------PSSPLVPGNPFEEPT--CTNPFEM--DSDSG 692
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap