Conserved Protein Domain Family
23ISL

?
pfam16620: 23ISL 
Unstructured linker between I-set domains 2 and 3 on MYLCK
23ISL is a natively unstructured region lying between the second and third I-set domains on higher eukaryotic myosin light chain kinase (MYLCK) proteins. The function is not known. It carries a highly conserved TSSTITLQ sequence motif which might be a binding domain.
Statistics
?
PSSM-Id: 318761
View PSSM: pfam16620
Aligned: 19 rows
Threshold Bit Score: 159.934
Threshold Setting Gi: 0
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669714   251 QGLDSAN-RSFVRETKA-T-NSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKD 327
9_pfamImport     1 QGLDNTN-RSFVRGTQA-A-NTNIRREVTNGIAKGPKLDSLETAAGSKNCSSAQRDVSATCVTDSQPQPLRESKLEPIRD 77
12_pfamImport    1 QGLDSAN-RSFVRGAKA-T-SSDIRREVTNGISKGLKPDSLETAAGNKNCSSPQSAGSPAWTTNSQPQALRESKLEQCGD 77
7_pfamImport     1 QPICMPP-KPTMLATKAiE-NSDFKQATSNGIAKELKSSSTELMVETKDRVSAKKETFYISREAKDVKQGQNQEANVAPL 78
8_pfamImport     1 PGLDNAT-RSFVRETKA-P-SPDIRKEVTNGISKDP-----ETVAESKNCSSPQRSVSSAWATNSHLKSLQEPKLKLCEE 72
10_pfamImport    1 PGLDKVN-RSFVRETKA-P-DADMRREVTNGIKKGLKLDSLETMAGSKNSSSLQKGGSLAWVTNSPSHSLWETEPEPCRD 77
6_pfamImport     1 QGVDKANsRSSVSGTKA-C-SSDIRREVTNGISKGLKLDSLETAAERRNCLSPQSGGPPAWATASQPQALRECELEPGRD 78
gi 444720864   355 QGLDNVN-RPSVRGTKA-TtSSDLRREVTNGIAKGPKLDSLETAAESKNCPSPQRGGPPSWATNSQAPPQRESQPEPSRD 432
gi 344240306   200 PGLDNAT-RSFVRETKA-P-SPDIRKEVTNGISKDP-----ETVAESKNCSSPQRSVSSAWATNSHLKSLQEPKLKLCEE 271
gi 884878604   251 PGLDSAN-RSSVRATKD-L-DADIKREVTNGITKGLKLDSVESMARSKTNPSLDKGGCQAQVSNSPSHSLWEPKPELCAD 327
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669714   328 SPRTAPQTP-VLQKTSSSITLQAARVQPEPRAPGLGVLSPsGEERKRPAPPRPATFP----TRQPGLGSQDVVSKAANRR 402
9_pfamImport    78 LPRKALRTP-VLQKTSSTITLQAAKAQPEQQAPASGALCPsREERKRPAAPPPATLH----ARQPDLQSQEGVSKVAVRK 152
12_pfamImport   78 PPRAALQAP-VLQKTSSTITLQATRVQPETRVPVLRALSPsGEERKRPAALHPATVL----TRHSGLGNQEAVDKVANRK 152
7_pfamImport    79 QESRGTKAPqVLQKTSSTITLQAVKVQPEPKAEPQTTFIRqAEDRKRTVQPLMTTQEnpslTGQASPRSREAENRAGARK 158
8_pfamImport    73 MPRKALQSS-VLQKTSSTITLQATKVQPEARVPGFGAFSPsGEERKSLAARQPATLP----TRQCGLGGA-VGNKFVTRN 146
10_pfamImport   78 SPRK-------VQKTSSTITLQATKVQPEPRAPTLGALSPsGEEQKRPAASQPATHP----TSWSGLESPEVVSTVATRK 146
6_pfamImport    79 PAQR------ILQKTSSAITLQPTRVQPEPRAPVSGALSPsGEERSRLAAPGPATLP----TRQSGPGSQDVVSKVATRR 148
gi 444720864   433 SLRKGSQNP-VLQKTSSTITLQAMKAQLEPKASVSGALSSsEEERKRPSAPHPVTLP----TRLSGVGSQDTVSKAATRK 507
gi 344240306   272 MPRKALQSS-VLQKTSSTITLQATKVQPEARVPGFGAFSPsGEERKSLAARQPATLP----TRQCGLGGA-VGNKFVTRN 345
gi 884878604   328 SSRKVLKTP-VLQKTSSTITLQATKVQPEPRAPALEALSPsREEKRRLATSQPTTSP----TTRPSPENPEVVSTVATRK 402
                          170
                   ....*....|
gi 300669714   403 IPMEGQRDSA 412
9_pfamImport   153 IAMESWRDST 162
12_pfamImport  153 ILMESQRDSA 162
7_pfamImport   159 TVKEEKREPL 168
8_pfamImport   147 IAIESQRESA 156
10_pfamImport  147 TPMESQREST 156
6_pfamImport   149 SPMDSQREST 158
gi 444720864   508 IPLDSRRDLT 517
gi 344240306   346 IAIESQRESA 355
gi 884878604   403 TPVESQKEWT 412
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap