Conserved Protein Domain Family
ISET-FN3_linker

?
pfam16625: ISET-FN3_linker 
Unstructured linking region I-set and fnIII on Brother of CDO
ISET-FN3_linker is a short section of natively unstructured sequence on Biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding proteins or Brother of CDO. It is found in higher eukaryotes and lies between the second I-set and the first fnIII domains, pfam07679 and pfam00041. The function is not known.
Statistics
?
PSSM-Id: 318766
View PSSM: pfam16625
Aligned: 17 rows
Threshold Bit Score: 81.3935
Threshold Setting Gi: 27777681
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 675781309  306 SRPSITPRLWQDAELATGTPPVSPSKLGNPEQMLRGQPALPRPPT-SVRPASPQCPGEKGQGAPAE 370
gi 637285428  403 AQPQTTPEPQHVSVAHFVHSVMSPTRLSNSEKVLKDKAVPLKPRP-TT-PVSSQCPTQD-QVSPAE 465
gi 620956617  433 ARPGSTFAPQQVSGVGWTLPPATPSMP--PDQVPSGTASLLQPRP-TTLTASGPCLSGEGQAVPAE 495
gi 395850337  409 ARPGTTLRPWQDAKLATATPPTPGSKPGHPDQMLRNRLGLPRPPT-SLQPASLQCPGEKGQVVPAE 473
gi 444719182  396 ARPGTTLRPGRDAKLATATPPVPPSRPSSPDQMLRGRLGLPRPLP-TAQPASPQCPGEKGQVVPAE 460
gi 612017605  405 ARPGTTLKPWREAKLGSSQSPTPSSRPSSPDRTLRDRAMLLRPRP-TALPASLQCTTAKGQVSPAE 469
gi 755763575  405 ARPGTTLRPWRDAKLDTATPPMPPSRPGSPEQMLRGHPGLPKPLT-SMQPASPQCAREKGQVAPAE 469
gi 344282553  409 ARPGSTLRPWRDAKSDVATPPAPPSRPGSPDQLLRGHPGLQRPLT-GMQSASLPCPGEKGQVAPAE 473
gi 27777681   404 ARPDTTLRPGRDTKPIAATPPMPPSRPSRPDQMLREQPGLVKPPTsSVQPTSLKCPGEE-QVAPAE 468
gi 338716265  405 ARPDTTLRPWRDAKPDTATPPMLPSRPGSPDQMLRGRQGLPRPPT-AAQPASPPCPGEKGQVAPAE 469
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap