Conserved Protein Domain Family
TUTF7_u4

?
pfam16631: TUTF7_u4 
Unstructured region 4 on terminal uridylyltransferase 7
TUTF7_u4 is the fourth natively unstructured region found on a set of higher eukaryote Terminal uridylyltransferase 7 proteins. The function is not known. The region is rich in arginine and lysine.
Statistics
?
PSSM-Id: 318772
View PSSM: pfam16631
Aligned: 11 rows
Threshold Bit Score: 124.529
Threshold Setting Gi: 351696760
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10435416    263 RRKVRRRRDQEDALNQRYPENKEKRSKEDKEIHNKYTEREVSTKEDKPIQCTPQKAKP-MRAAA-DLGREKILRPPVEKW 340
gi 884930639  1335 RRKVRRRQNQEDTLHQRYAENKDKKSKEEKDIQNKHTEKETSAREDKPVPCVAQKAKM-ARVAA-DPGREKMLRPLVERW 1412
gi 395514280  1353 RRKVRRRHDHEDIKNQRYPENNEKRNKDDKEIQNKSTEREMLVKEGKLQS-TPQKNKQ-GRGVVlEMGRDKVSRQSLEKW 1430
gi 565302372  1343 RRKLRRRHDSEDPKNQRYTENKEKRSKDEQETPIKTTEREVLLKDGKLQICAPNKNKS-GRGGM-ETGKEKSPKPMGEKW 1420
gi 525027142  1365 RRKVRRHRDYEGA--QRFGEIKEKRSKDDKEMQNKPTEKENLIKEGKSHLCTPQKRKL-ARVVV-ETGREKTPRQSAEKW 1440
gi 1043437802  983 RRKVRRRKN-ENAGNQRYPETRNQRMTE--EAASKGAENETSRLDGKQTSNTPKKPKQgARGAN-EANREKPQRLPTEKW 1058
gi 483515945  1353 RRKVRRQRDYEDSKNQRYPENKEKRSREDKETQNKTTEKESSVKEGKLHPFTSPKSKP-TRGIV-ETGREKSPRQSAEKW 1430
gi 429903875  1361 RRKLRRRRDYEDSKNQRYTENKEK-SKEDKEIQNRTTEKESAVKEGKLHVFTPQKNKV-ARGVV-ETGKEKSPRQSTEKR 1437
gi 940766149  1178 RRKVRRRRDQEDTPNQRYPENKDKRSKDDKEVQNKCAEREVSSKEEKPVQYTPQKAKP-VKAVV-DLGREKMLRPSAEKW 1255
gi 149039758  1042 RRKVRRRRDQEDTPNQRYTESKEKRSKEDKEIQNKYTEKEVSAKEDKAAPCTAAKAKP-MRAAV-DLGREKLVRTPAEKW 1119
gi 351696760  1370 RRKVRRRRNQEDTLHRRYPENKDKKSKEEKEIQNKYAEREVSAKEDKSVPCAAQKAKT-VRAAV-DPGREKILRPLMEKW 1447
                           90
                   ....*....|
gi 10435416    341 KRQDDKDLRE 350
gi 884930639  1413 KRQDSTDFRE 1422
gi 395514280  1431 KRQDEKDLRE 1440
gi 565302372  1421 KRQEDRDLRE 1430
gi 525027142  1441 KRLEDRDIRE 1450
gi 1043437802 1059 RRSEDREPRE 1068
gi 483515945  1431 KRLEDRELRE 1440
gi 429903875  1438 KRLEDRELKE 1447
gi 940766149  1256 KRQDDKDLRE 1265
gi 149039758  1120 KRQDDRDSRE 1129
gi 351696760  1448 KRQDNKDLRE 1457
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap