Conserved Protein Domain Family
APC_u13

?
pfam16634: APC_u13 
Unstructured region on APC between APC_crr and SAMP
APC_u13 is a short region of natively unstructured sequence lying between the fourth creatine-rich region, APC_crr, pfam05923, and the SAMP pfam05924, domains on APC or adenomatous polyposis coli proteins in higher eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 318775
View PSSM: pfam16634
Aligned: 9 rows
Threshold Bit Score: 85.998
Threshold Setting Gi: 972955125
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 958666103  1682 IESPPNELAAGEGVRAGAQSGEFEKRDTIPTEGRSTDEAQRGKVSSITIPELDD 1735
gi 874492425  1694 IESPPNELANVDSVGTGAESGEFEKRDTIPTEGRSTDDSQRAKSITVTAPGLDD 1747
gi 149642301  1667 IESPPNELAAIENIGTGAQPAEFEKRDTIPTEGRSIEDIQRGKNSASTTPVLDD 1720
gi 1023020942 1627 IESPPNELAGVEGTSTGALLGDFEKRDTIPTEGRSTDDIQIGKSSNVNTSAFDD 1680
gi 637318253  1662 IESPPNELTGAETSGTGVESAEFEKRDTIPTEGRDTDDAYRGKNSTGTTVGLDD 1715
gi 395514172  1568 IESPPNELAVIESTGTAGAQLEFEKRDTIPTEGRSTDDIQTGKIPNITTSALDD 1621
gi 301613942  1666 IESPPNELTNNDQPNTGSLSTDLEKRDTIPTEGRSTDDTDASKKLNPSTSVLDE 1719
gi 565320006  1637 IESPPNELASTGIAISGMESAEIEKRDTIPTEGRNTEDAQRGKSSS--TVGLND 1688
gi 972955125  1641 IESPPNELANAESTSMGAGPATIERRDTNP-EGRSTDTKDVIKGPSTPPVAVed 1693
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap