3U12


Conserved Protein Domain Family
UCH_N

?
pfam16674: UCH_N 
Click on image for an interactive view with Cn3D
N-terminal of ubiquitin carboxyl-terminal hydrolase 37
UCH_N is a domain found at the N-terminus of ubiquitin carboxyl-terminal hydrolase 37 or 26. The function is not known.
Statistics
?
PSSM-Id: 318809
View PSSM: pfam16674
Aligned: 36 rows
Threshold Bit Score: 124.251
Threshold Setting Gi: 410925226
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3U12_A        19 S----L--KIHGPIRIR--SXQTGITKWKEGSFEIVEKENKVSLVVHYNTGG-IpRI-FQLSHNIKNVVLRPSGAKQS-R 87
gi 760997666   3 P----L--KVHGPVRMR--SMQTGITKWKEGSFEIVEKDNKVSLVVHYNVGG-IpKT-FQLSHNIKSVTLRPNGRKLC-C 71
gi 565305610   3 P----L--KLHGSVRMR--SIQTGTTKWKEGTFEIVDKDSKVILLVHYNAGG-IpKI-FPLNHNIKNVVVRQTKGKLY-C 71
gi 637247970   3 L----L--KLCGSIRMH--SMQTGTTKWKEGTFEIVDKDSKVTLVIHYNAGG-IpKM-FQLNRNIKKVVVQPNKGKLC-R 71
gi 556963968   3 P----M--KVHGPIRIR--SLQTGTTKWKEGRFEIVEKDNRANLMVHYNAGG-SpKT-FQLNQNIRKVILQMSGAKQQrR 72
gi 847165792   3 L----H--SLHGPIRIH--CLKVGTSKWKEGCCEVIEKDNKYCLVVNYNAGG-M-PTrFQLNQNIKTIVVKPNGGTQS-R 71
gi 973169364   3 A----TvpKLLGSVRIN--SLQLGTTKWKEGSFEIHEKDNKVNLFVRFNSGG-VpKI-FQLNQNVKTVSLGP-KQNQC-R 72
gi 542255586   7 K----V--SSGGAVKIRftSLDLGTTRWKEGTFEILEKDNKVNLCLRFNCGGaS-KT-FQLNQNVKNIS-----QNVN-R 72
gi 688569768   3 AavprL--TSGGAVRIRirCGELGTTKWREGVIEIQERDNKINLLVKFNSGG-ApRV-FQLSHNVKSVSWFQ-THGPN-R 76
gi 410925226   3 qtgpiV--SSSGTVQIRfsSIDLGTTKWREGTFEILEKDNKISLCLRFNCGT-L-KI-FQLNQNLKT-----FSQNLS-R 71
                         90       100       110
                 ....*....|....*....|....*....|...
3U12_A        88 LXLTLQDNSFLSIDKVPSKDAEEXRLFLDAVHQ 120
gi 760997666  72 LMLTLKDTSFLTIDKVPLKDANEMRMYLDAVHQ 104
gi 565305610  72 LMITLKDSSVLTLDKIPSKDANEMKLYLEAIQN 104
gi 637247970  72 LMITLKDSSFLMVDKIPLKDAEEMKLFLEGVQN 104
gi 556963968  73 LLLMLKNSSSISIDKVPHKDAEELKQYLETLQQ 105
gi 847165792  72 FMLTLKDASSLTIDKVPLKDAENLKHFLESLDK 104
gi 973169364  73 IQVVLKDSSSLIIDKVPLLLAQKFRDYLEKLKQ 105
gi 542255586  73 IVLTLKDNSVITLDRMPQPLVQKTKEYLEKLKQ 105
gi 688569768  77 MTLTLKDSCIVMMDKLNMLVAKKMKEYLETVKL 109
gi 410925226  72 IQLNLKDSSVIVLDKVPQMLVQRTYEYLKKLKQ 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap