2LUA


Conserved Protein Domain Family
MSL2-CXC

?
pfam16682: MSL2-CXC 
Click on image for an interactive view with Cn3D
CXC domain of E3 ubiquitin-protein ligase MSL2
MSL2-CXC is an autonomously folded domain containing that binds three zinc ions. It lies on the E3 ubiquitin-protein ligase MSL2 in eukaryotes. The CXC domain critically contributes to the DNA-binding activity of MSL2. It carries 9 invariant cysteines within about a 50 residue region.
Statistics
?
PSSM-Id: 318817
View PSSM: pfam16682
Aligned: 14 rows
Threshold Bit Score: 58.9837
Threshold Setting Gi: 409106964
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
2LUA_A           1 SPPKPKCRCGISGS-SNTLtTCRNSRCPCYKSYNSCAGCHCVGCKNPHKEDYV 52
gi 968082416   754 PKQRKHCRCGISGP-STPK-TCRNNRCWCYINGNSCTDCSCQGCNNPHKQDYI 804
gi 194765961   444 kEEKSLCRCGISNS-KKPLmTCRNNRCPCYKAGNSCANCHCVACKNPHKVDFI 495
gi 1025254136  340 tqEKKGCKCGRATQ-NPSVlTCRGQRCPCYSNRKACLDCICRGCQNSYMANGE 391
gi 195440288   451 QKQRKVCGCGQKVG-QKKRnVCRSNRCYCYSNGYSCSDCNCQGCKNPLKSDin 502
gi 260800626   195 PPEKRSCRCGTFCE--PSElTCHRQRCPCYSNQLSCTGCRCRGCKNPYKDDSV 245
gi 347963996   565 ALKRKGCRCGNATP-TPGKlTCCGQRCPCYVDSKSCVDCKCRGCRNPHRADGL 616
gi 194202680   111 KPPKPKCRCGISGS-SNTLtTCRNSRCPCYKSYNSCAGCHCVCCKNPHKEDYV 162
gi 198473707   817 KPPKPICRCGTSGVaVNPKtTCRNTRCPCYKSGNTCTNCHCVGCHNPHKTDFL 869
gi 195170669   550 KNAAAICRCGSSAKvVNQKtTCRNNRCRCYVSGNSCTNCHCFGCHNPHKTDFL 602
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap