4B7Y


Conserved Protein Domain Family
zf-RING_10

?
pfam16685: zf-RING_10 
Click on image for an interactive view with Cn3D
zinc RING finger of MSL2
zf-RING_10 is an N-terminal domain on E3 ubiquitin-protein ligase msl-2 proteins. The domain binds MSL1 and exhibits ubiquitin E3 ligase activity towards H2B K34, the histone proteins.
Statistics
?
PSSM-Id: 318819
View PSSM: pfam16685
Aligned: 17 rows
Threshold Bit Score: 106.626
Threshold Setting Gi: 241859075
Created: 7-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
4B7Y_C         42 LSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCK---DYEQFEENKQLSILVNCYKKLCEYIT 111
gi 432929700   42 LSCLVCGNLLQDPIAPTNSSCQHYVCRGCKGQRMQLKPSCSWCK---DYTCFEENRQLSLLVQCYRKLCLYII 111
gi 1134484163 101 LSCAVCCRLLLEPHTPAELNCQHHVCRGCVGERKKLKPSCASCK---DYNRYVENTQLRMLLQCYKSICEYIk 170
gi 347963996   37 LSCAVCCKLLVEPHSPVTGDCQHHICRVCVGKHKKLKPACRFCK---GLLQYRENTQLRLLLQCYKSICTFIR 106
gi 321458435   39 LSCTVCDLLLVEPYSP-ESSCQHHVCKSCRGRKKKLKPSCSWCK---CYNSYSENVQLRILLQCYKKLNEYLV 107
gi 241859075   39 llCSVCSSLLVVPMTSTMPNCQHSVCKGCLGKKTRLKSSCLGCE---DHSKFAENLHLRILLQCYKKFCDYLG 108
gi 153792548   39 LSCTVCGNLLKEPYTPTSSGCQHHVCKKCKGGRKKLKPSCSWCK---DYENYTENLQLRILLQCYKKLCEYFM 108
gi 195440288   41 LSCVVCCRLLTDPYEPKGPQCGHYVCRLCVRGDKRLVPECPICRncsGFTNYEENRVVTLLLLCYKSICIYMM 113
gi 941806644   42 LSCLVCGNLLQDPIAPTNSSCQHYVCRGCKGQRMQLKPSCSWCK---DYACFEENRQLSLLVRCYRKLCLYIT 111
gi 551515805   42 LACLVCGKLLEDPISPTHPECQHYVCLGCKGQKMQIRSSCNRCK---DYSCFQENKQLSLLVQCYRQLCLYIT 111
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap