2K4V


Conserved Protein Domain Family
DUF5064

?
pfam16703: DUF5064 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF5064)
This is found in Pseudomonas species. Several members are annotated as being acetyl-CoA carboxylase alpha subunit, but his could not be confirmed.
Statistics
?
PSSM-Id: 318833
View PSSM: pfam16703
Aligned: 16 rows
Threshold Bit Score: 142.803
Threshold Setting Gi: 505289489
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2K4V_A         4 MFEPGH--LHLVSlP-GLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAF-NFASDATRVAQKH 79
gi 81540705    1 MFIPGH--LHLAS-AsEVDRQAFDIHLRYRVLEAEARPVAVHFDMEGRIDGQPFSESFELPRDAAV-HFASRASRLARRH 76
gi 81732148    1 MYEPGH--LHITHvAlQPSEVSYDIHLRYEVNEDPKEGTSMHFTMQGQINDKPFEEQFQLTRDLAF-NFAHDASRIAIRH 77
gi 81442007   23 QYHSGH--VHIERtAlNNADHSYDLNIEYEAVADPKEGRGIQFHMHGSIEGKPVEEKFFLAKDQVLpSFLMLLTRKAQSY 100
gi 123653585   3 MFEPGH--LHIERhAlNKDDFSYNLCIDYEVAHDPKEGKGMLFTLHGTIEDKSLKEQFFLAKDLAF-DFARHATRLAQQH 79
gi 503558217   1 MFEPGH--FHRSNsVaNGDVPTYAIDLHYDIRQDAAEGPMLQMSLKGEIDGAVFEESFELHRDTAF-NFASVVSRLAHKH 77
gi 145572493   1 MFGPGH--VEISRlP-TEARPGYHLTLDYHVEGAEPRPEWACFHLRVEAPQVHIDEQFRMHRDVAY-NFLQRIRRCLRDH 76
gi 505289489   1 MTTPAQvtLHSSQ---GIDRQQYIIRLSYQVENPASRDALVRFQLDGEIDGQPFNDGFDLPGDIAF-NFASSAARLLRRH 76
gi 505291282   1 MFEPGH--LHLQAmP-GLDQQEIDAHIHYEVRKDAAKGIYVHFTMKGEIDRNAFSEEWDMPKEQAF-NFASDATRIAQKH 76
gi 502036784   1 MFTPGH--AHREQkVdKLNRQAFICDVYYEVREDAREGAMLHMRMEGEIDGRPFAEECELHRDMAF-DFLNALTRIAVRN 77
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
2K4V_A        80 GLHP-KFGAITRVHKEYDAMFEDIRAKLHAHPGEPVDLERI 119
gi 81540705   77 GLRL-RQGPIVRQRREYDAMFDDLRRRLKLKSGEAIDLDRY 116
gi 81732148   78 GLPN-SASLPIAQHKDYDRIFADIRDKLHAKPGDPVKPEHL 117
gi 81442007  101 LAPPkKFETLSSPHKLYDHMFADIREKLDVKSGDPIKPEHL 141
gi 123653585  80 GLP--KSASIASMHKYYDEMFEDVRKQLDVKPGDPVKPEHL 118
gi 503558217  78 GLPT-SVVLISHEHEEFDQMFEDIRHRLDAHSGDPVDLDHL 117
gi 145572493  77 GVQV-RQDILFGFHALYDPLYADLRQQLHLQPGEAVDLDRF 116
gi 505289489  77 GLRL-CPGPVVRFRKEHDQVFDDLRRQLRAEPGKPVDLQRM 116
gi 505291282  77 GLHP-RFGAVVRNHKEYDAMFEDIRQKLGTHYGDPVDLNDv 116
gi 502036784  78 GLHP-RFGPVLREHGEYDAMFRDIRDKLGLRPGDPVDLGHL 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap