2V7S


Conserved Protein Domain Family
LppA

?
pfam16708: LppA 
Click on image for an interactive view with Cn3D
Lipoprotein confined to pathogenic Mycobacterium
This is a family of lipoproteins found only in pathogenic mycobacteria. These pathogenic lipoproteins may play a role in host-pathogen interactions. Lipoproteins localized to the cell-envelope of pathogenic bacteria are major determinants of virulence. The proteins are localized to the cell-surface via an N-terminal lipidation carried out by a transferase - pro-lipoprotein diacylglyceryl transferase Lgt - which attaches a diacylglyceride molecule to a sulfur atom from a crucial cysteine, and a consecutively acting lipoprotein signal peptidase LspA that cleaves the signal peptide just before the modified cysteine. When the peptidase is inactivated the pathogen has difficulty in replicating inside macrophages.
Statistics
?
PSSM-Id: 318836
View PSSM: pfam16708
Aligned: 16 rows
Threshold Bit Score: 146.735
Threshold Setting Gi: 614090657
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2V7S_A        35 PDTsRRLT-GEQKIQLIDSXRNKGSYEAARERLTATARIIADRVSAAIPGQT-WKFDD---DPNiqqsdrN--GALcD-K 106
gi 81345727   28 AGE-EGPLsPEKVAELENPLRAKPPLEDAKDQYRAAVTQLANAITALVPGLT-WRTDM---DTW------T--GCG-G-E 92
gi 433300749  29 vsQpDAPTpSSDAAKALDELKSLPSLEDTTTQVQAAIDEITTAASKVVPDIV-WTTAT---NEDt-----G--NCE-A-P 95
gi 576088131   2 FENpYQNTdPERTAEAAEQLTKLPTLEETEIHVEAAVNELADYVSTLVSGLT-WEWAN---NREn-----E--SCD-R-P 68
gi 916331731  24 MNDpDRPAsKEDIAHAEAKMRQLPSAEDTERQLAALLQRIADAAKTVAPELE-WRVLR---DRGq-----GklGCP-S-P 92
gi 503593016   1 MNQpYGPTpPTEAAQALEELRSLPSFEDTRVQVQAAMKEITVAAGELISGVV-WENPH---EGSg-----E--GCQ-RrP 68
gi 531066157  17 cagrpGTTpGGDVEDQRATLQQRPSIEEASARYDEMQRAVRERLSAEIGSLN-WTPRE---PMSs-----A--GCA-D-- 82
gi 374658944  35 GGDiNDDPnAGTVQEQFDTLLQRPSFEEMTERYQEMVTKVR-RATVQLGGIPeWRDSKgstPISg-----A--GCG-F-D 104
gi 262083770  27 FGEtEDVs-PQRLTELNDELRGLPTLDVTLEDYRRLRERLTLRIREVAPETY-WRSSAiegDRYpd--hrQ--SCS-G-E 98
gi 502630934  47 DRSmAGLPsDDEVVDARRVLMGLPSFEEEQGTSAMVLGDIRTALEVELGPVD-WIHDEv--RRGa-----A--GCT-P-P 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2V7S_A       107 LTAD--IARRPIAn-SVXFGATFSAEDFKIAANIVREEAAKYGATTESSLFNESAKRDYDVQGN--GYEFRLLQIKFATL 181
gi 81345727   93 YEWT--RAKAAYF--MIVFSGPIPDDKWLQAVQIVKDGVEQFGATGFGVMKNKPADHDVYFAGHg-GVEFKCSTQKAAVL 167
gi 433300749  96 YEQT--DGKRHFLpnRVANDVTLTEQQWNDLLNVAKDAAAKLQATDVQVMQDQPGKHDVWFTGPa-GVFIKFSYKGNVVV 172
gi 576088131  69 YDQT--QGSKVKLk-NRISHPAIPDAVWPQVLDRARQLAEGIGATGVEVFADEPGNHVVRFYSLe-GTE-LFVGSRGAVI 143
gi 916331731  93 YLET--IGVSMTTd-SLTSAVPITDDEWPRVLQATRDLAAENGITALTVRADTPGRHDITLHAPdhGNEITLGTNKAALL 169
gi 503593016  69 YEQA--NARGYLLpdEVAVRVAVSERDWVGIQEAARIAAAKLDATELQVMQDQPGNHDVGFYGPa-GLYIKVGYRGNLVV 145
gi 531066157  83 FPNL--GGETRVLe-SWRSAGNLPDADWPRAVEIVAEVTAQYGFGAVEVVVDRAGDHEITATDQy-GASYLFGTAKNTLL 158
gi 374658944 105 FPDIgsDGGTRQIn-GGVSEGAIPDDRWPEVIERVGKIAESYGFNRREVFKDEPGDHDVRFYDSy-GGDFVFGTKINTSM 182
gi 262083770  99 WADT--DGRQVQLd-RRVSAVPIGEAHWSEALAVVRETVAEYGLKQIGAYRDLPDDRDIRFSGPg-GSALMFGTFKAAVL 174
gi 502630934 115 ESEI--PGALSEGa-RSRGALPGGGDQGERALEIVEEVAAQHGFAETSRFVDGTGVQYADMTSDr-GGNVSAVAGDRFGI 190
                        170
                 ....*....|
2V7S_A       182 NITGDCFLLQ 191
gi 81345727  168 TAQSDCRISR 177
gi 433300749 173 SGYTGCRLPN 182
gi 576088131 144 GSNTGCRLPA 153
gi 916331731 170 TGLTGCRYRE 179
gi 503593016 146 SGYTGCRLPR 155
gi 531066157 159 TVSTGCHLPQ 168
gi 374658944 183 VISSGCFLKN 192
gi 262083770 175 SIQTPCRLPA 184
gi 502630934 191 RVTSSCFLTA 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap