4DIX


Conserved Protein Domain Family
SCAB-IgPH

?
pfam16709: SCAB-IgPH 
Click on image for an interactive view with Cn3D
Fused Ig-PH domain of plant-specific actin-binding protein
This family is a fused Ig and PH domain found on plant-specific actin-binding proteins or SCABs. SCAB proteins bind, bundle and stabilize actin filaments and regulate stomatal movement. The Ig-PH fusion domain is at the C-terminus. This domain has the N-terminal Ig beta-sandwich fold consisting of two antiparallel beta-sheets built from strands beta1 and beta2 and strands beta3-beta6, respectively. The C-terminus of the fused domains adopts the PH fold, of seven beta-strands, beta7-beta13 and two alpha-helices, alpha1 and alpha2 arranged into a beta-barrel. The Ig and PH domains appear to be truly fused together into an integral structure which displays a few conserved patches on the surface, particularly of the PH part. The canonical phosphoinositide-binding pocket of the classic PH domain is degenerate in this fused one, and the charge on the pocket suggest that the Ig-PH domain contains a non-canonical binding site for inositol phosphates. There are a handful of bacterial members at low threshold but they are missing the PH part of the fused domain, and appear to match little else.
Statistics
?
PSSM-Id: 318837
View PSSM: pfam16709
Aligned: 19 rows
Threshold Bit Score: 344.308
Threshold Setting Gi: 168029740
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DIX_A        15 YEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIY-DGHSLSLST 93
gi 75142454  283 YELEGLESLGSMLRIVSQSDGYVDLSRSTIQWFRVQPEGNKKEIISGAIKQAYAPEPHDVGRYLQAEINH-CGEISVVKT 361
gi 302813784 256 YRVDGTECLGSLLSLSPVDEQAPDLSSCKFQWHRISADGGKKELISGAVKSQYAPDPFDAGRILRVDITLpDGAKEFLST 335
gi 168029740 228 FELQGEERLGSSLVIVPADSLSPELGKCKFQWHRM--HGIKAETIIGATRPQYAPEPLDVGKKLKVDIDLpDGSRESLAT 305
gi 571506983 238 YELEGNETLGSYLQIQPCSDNAPEVSKCSIQWYRVSSDGAKKELISGATKSVYAPEPFDVGRILQVDIIS-ESEHVTLST 316
gi 460410961 280 YELDGTEALGSCLHIQPCSLAATELSECTIQWYRLACEGGKQEPISGATKSVYAPEPFDVGRILQAEITY-GDQTTSVTT 358
gi 297825901 281 YEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKRELISGATKSVYAPEPFDVGRVLHADITY-DGRLLSLST 359
gi 242046734 283 CELKGLETLGSMLRIVVQDCAHVDFSNCSIQWFRIQPEGSNQEIISGATKPVYAPEPHDVGRYIQAEIKF-GGQISIAKT 361
gi 586669116 281 CELDGDESLGSYLRIVPNVNTTLDISRCTIQWFRISAERSKRERISGATKSVYAPEPFDVGRYLQAEIVA-DGEKLLVTT 359
gi 219362459 281 FELEGSNTLGSQLCIIPRVDGASNITNCPIQWYRVIS-GGTRELISGATKFMYAPEPFDVGRLLQAEIVL-NADKIIVQT 358
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DIX_A        94 VGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGN 173
gi 75142454  362 AGPVDPAAGLVDYVETLLRNPETEYNVVVLQVNGIKQPTDSIHVLSIGKLRMRLAKGKTVIAKEFYSSTMQLCGMRGGGD 441
gi 302813784 336 TGPVDPAPGLGNYVEALAKKGGSEFNVVIVQQNGEYVEKQALHALEIGRLRMKLRKGLTTKIKEKYAAGMQLCGARGGGQ 415
gi 168029740 306 SGPIDGAAGLGQCVEALVRKGGAEFNVRIFQENGEHVVKATFQVLVIDKSRMKLFKGRHNRAKEEYSSSMQLCGARGGGD 385
gi 571506983 317 AGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMNGSHHPTESIHVLHVGKMRIKLCKGKTTIAKEYYSSSMQLCGVRGGGN 396
gi 460410961 359 AGPIDPAAGLGNYVEALVRRHDIEFNVVVVQMNGTDHTSETIHVLHIGRMRMKLCKGKTSIAKEYYSTSMQLCGVRGGGN 438
gi 297825901 360 VGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGN 439
gi 242046734 362 AGPIDPAPGLVDYVEALVRNPETDYNVVILQVNGIAQAADSLHVLCIGRLRMRLAKEKAVVAKEFYSSSMQLCGVRGGGD 441
gi 586669116 360 TGPIEPAPGLGNYVEALVRKPDTEFNVVL-QMNGVDHPSHSLHVFHVGKMRIKLRKGRITKAKEPYSSSMQLCGLRGGGN 438
gi 219362459 359 DGPVDNAAGLERYVDSLMKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLRKGWSTKARESYSTTMKLCGSRGGGN 438
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
4DIX_A       174 AAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPED 222
gi 75142454  442 AAPQAMYWQPRRDLSLVLGFETARERNSAIMLARRFAIDCNIILAGPGD 490
gi 302813784 416 AAPLAMFWLVKRGLTYMLGFESERERNAAIMLARRFAFDCNVMLAGPDD 464
gi 168029740 386 AAARSLYWVANKSLTFMLVLDSERERNAAIMLARRFAYDCNVILGGPDD 434
gi 571506983 397 AAAQALFWQPKQGHSFVLAFESERERNAAIMLARRFAFDCNIMLAGPDD 445
gi 460410961 439 AAAQAAFWQVKTGLSFVLAFETERERNAAIMLARRFAYDCNIMLSGPDD 487
gi 297825901 440 AAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTLAGPDD 488
gi 242046734 442 AAPQAIFWQPRKDLSFVLAFETTRERNSALMLARRFAIDCNIILTGPGD 490
gi 586669116 439 AAAQALFWQPKKGVSFTLAFESERERNAAIMLARRFAFDCNIMLAGPDD 487
gi 219362459 439 AAARAVFWHPRKGSSYTLAFETDRDRNAAIMIARKFASNCNIALAGPGD 487
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap