2X9Q,3OQI


Conserved Protein Domain Family
CDPS

?
pfam16715: CDPS 
Click on image for an interactive view with Cn3D
Cyclodipeptide synthase
This family of proteins includes enzymes involved in the synthesis of cyclodipeptides using aminoacyl-tRNAs as substrates, including cyclo(L-leucyl-L-leucyl) synthase, cyclo(L-tyrosyl-L-tyrosyl) synthase and cyclo(L-leucyl-L-phenylalanyl) synthase. They are structurally similar to class Ic aminoacyl-tRNA synthetases (aaRSs).
Statistics
?
PSSM-Id: 318841
View PSSM: pfam16715
Aligned: 18 rows
Threshold Bit Score: 197.915
Threshold Setting Gi: 123657437
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2X9Q_B        64 FLVRPFTQQCQIIHTEGDHAVIGVSPGNSYFSRQRLRDLGLWGLTNFDRVDFVYTDVHVAESYEALGDSAIEARRKAVKN 143
gi 511270559   2 pRPLPLTEHCADPLARAEHVCLGVSPFNSHFTVERIADLARWAMSAFRGFHFFVPDGPSAFTLEALGYDPVRAAQKAQRQ 81
gi 503907677  57 FNCRPLTPNCARVVDAGEHAVVGVSLGNSYFRGDILRALLRWLSGRFAQLDVVIPDSSYRDNLLAAGYQPAHADGKAHRE 136
gi 503910987  13 FGFFPVTHTCRLIWEEGAHLTIPVGPWSPGASADRIAALTCWSARHFGQVDVVRTDLGVEGVLAAFGHDPWDARRRAAAL 92
gi 754231912  15 FTVEPFTEESRLIWERREHVVFGVSPGNSYFQVPRMAELFGWLRGESDRIDVVIPDSALVHTYLALGYEERRAERKARAE 94
gi 504724216  16 FEARPFTTNCERLVEKGEHALVGVSVGNGYFSQYRIAQLLDWTGRRFASVDVLYADLHVESAFRASGMDPEHAARRTHRA 95
gi 504912708   2 llPTPLTEHCAAPLRSGRHVCVGVSPFNSYFTVDRITALARWAMREFERFHFFVPDRAAVHTLEALGYDPARARLKARRQ 81
gi 504845967  12 LRLQPYTDHCRVIADEGAHVVIGVSPGNSYFTAQRLRELTRWGMDHFDQVDLVYTDLHVSDMYEALGYGADEARRKAVKN 91
gi 558529097  14 vRVLPFGASSERILQRGDHALFGVSTGNSYFSRRNLANAMAWAVERFAAVDVVHADIALEAMLEALGYERVAARKSVAKQ 93
gi 502917220  17 FDVLPFTGSCRRVFERGEHALIGISAGNSYFSQERIAQLLRWAQRHFAEVDVLYADLHLDTMYMASGGSREHASSRANRA 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2X9Q_B       144 IRGVRAKITTTVNELD-PAGARLCVRPXSEFQSNEAYRELHADLLTRLKDDEDXRAVCQDLVRRFLSTKVGPRQGATATQ 222
gi 511270559  82 GNYTRNKIVRALQQVC-PSDPHTLILDASVLEADSAYLGLLSEAHHRFATDPEFAEQCLGATGWVLDRRLPEGEHPTRDQ 160
gi 503907677 137 AATARSRVLRSWREAGvPLSGDAHVHLLSDLTANPAYRALRLRVEHALRLDPELYAECLAMSRAALRSQLKGV-TPSAAQ 215
gi 503910987  93 DRAVRATIAQGVREAG-AAGRRVRVRALSDFADHHMYRVLCHRVEAALTAEDELRQACDHTVQQFLASRLQDSGPATEDQ 171
gi 754231912  95 VNVLRNRVSRAWEAAG-GPRPGDGLNLMSELEGGEVYRARLAECERALREDEVLRGTSAEMSREVLALKGHRG-MASDEQ 172
gi 504724216  96 LRDVRRRIRRAVESAG-DVPARVRTVALSEIAEFPGYRTAARRIDREIEQNPLLRAACEDHVRHVLG----PAEDPEGAR 170
gi 504912708  82 GQYVVNKICRALRDLDvPCPAD-HVLDGEALAANPCYQALLAQAHGLFAADGEFAGQCLEATRWVLDRRLPDGAAPTGTQ 160
gi 504845967  92 LRGVRAKVAAAVAEAD-PTGVRVRGRGMSEFGDVPAYRALHRTVLDAVAADPLVRETCDALTGIFLAGKLAPGQRTDERQ 170
gi 558529097  94 LRGVRRRIDGALEDIG-AAAERVRARPLSAFLDHPSYREVRARTRAALRTDVELRSVRDAMAYQFLAKRLKPDDLPTPAQ 172
gi 502917220  97 LKDVRRRIRRAVEAAA-PDAGNVRVRALSQCTGLPGYRDVAYRLDREHATDPRVRRACEEHVRHVIGAQP----DPDGAR 171
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
2X9Q_B       223 EQVCXDYICAEAPLFLDTPAILGVPSSLNCYHQSLPLAEXLYA-RGSGLRASRNQGHAIVTP 283
gi 511270559 161 LRSAVRYFLAELPMFVGTVAVAGVESSVFAYHQRVGFLERLYR-GELSWRPLPGQGFVVLEQ 221
gi 503907677 216 AEAGIQYLTAELPFFIGSAELFGVSSSLCFYHKPVPVADLLFT-RPGPLRPPREQGYALIQP 276
gi 503910987 172 LRAGRAYLTAELPFLVDTPGLLGVPSSVFCHPVATPLAEVLFG-RGSGLRAARDQGYAVVRP 232
gi 754231912 173 VERAMRYLLAELPFFLASSEIFDVPTSVNFYHRKLPLAEVVFS-GESLLRASPRQAYATIRP 233
gi 504724216 171 FRAGMDYLRAELPFLLSSPEVLDVASSVCCYHVLMPVLPRLRG-EASCFHPR--QGHLVLRP 229
gi 504912708 161 LRQAVRYFLAELPMFVDTPAVVGADSSVFAYHQRVGFLELLYA-RELAWRPRPEQGFVVLRP 221
gi 504845967 171 REVCRAYICAEVPLFLDTPAILGVPSSLNCYHQALPLADLLYG-RGPGLRASRNQGHGILTP 231
gi 558529097 173 VEAALAYVDAELPFFVDTPRILGVASSVHCYHTVLALGRLLFGeRRMALRPADNQGYAIVac 234
gi 502917220 172 LRAGLAYLRAELPLLLSTPRVLGLPSSVCCYHALMPILSRLRG-ATSCFHPG--QGHVILRP 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap