4KT6


Conserved Protein Domain Family
IFS

?
pfam16718: IFS 
Click on image for an interactive view with Cn3D
Immunity factor for SPN
Immunity factor for SPN (IFS) binds to and inhibits the SPN toxin.
Statistics
?
PSSM-Id: 318844
View PSSM: pfam16718
Aligned: 12 rows
Threshold Bit Score: 200.657
Threshold Setting Gi: 501962221
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KT6_B         1 MYKVPKGLEHYQKMFQKEVTVNDLKKYLIGSDKEYRITRRDSYMGDISDPEVILEYGVYPAFIKGYTQLKANIEEALLEM 80
gi 488989420   5 KLKNKENYKHFVKHYLEVMREGKEAEAFLGTEAKYCFRQRDSYEVDSTDINVLMEYCLYPLYVEGDRDIARRTFDILKNF 84
gi 489134073   1 MYNCPNGYEQYVALFNKSLSKRELIRYFVGQDKTHRLTSRDSLMSDISDSEFIFEYCLYPSFLQGKTEIKELVQEALLEM 80
gi 493790316   1 MYNCPSGYEKYIPLFNKTLDKETLTRYFVGQDKKYRLNNRESLMSDISDTEFILEYCLYPVFLQGKTDIKDLTQETLLNM 80
gi 827480858   1 MYKVPKGLEHYQKMFQKEVTVNDFKKYLIGSDKEYRITRRDSYMGDISDPEVILEYGVYPAFIKGYTQLKANIEEALLEM 80
gi 447118200   5 KLKTDTEWD--IMRYKKAIENHREIDAFLGINPEYRIGHRDSYYQDITDTHILIEYSLYPIYVEGDFDIPDRIFDILKEL 82
gi 501962221   5 FFNNDVD-ERRRQLYLDARSKGHLEKCFRG-DSGFKINAKDSYFQSITDINVLIERCLYPLYDLGDSVIPHETERILSQF 82
gi 489002879   5 EIPEPKDYQNFVKHYLEVMREGKEAQAFLGTEVKYRFRQRDSYELDSTDIGVLMEYCLYPLYVEGDRDIARRTFAILKDF 84
gi 896606663   5 KLKNKENYQNFVKDYREIMKEGKEAEVFLGTEARYRFRQRDSYELDSTDIGVLIEYCLYPLYVEGDRDIARRTFEILKDF 84
gi 489004384   5 KLKNKENYKHFVKHYLEVMREGKEAEAFLGTEAKYCFRQRDSYEVDSTDINVLMEYCLYPLYVEGDRDIARRTFDILKNF 84
gi 495364159   1 MYKIPKGLEDYQKIFQEERSLKEFITFFIGKDKNYRITKRDSYMGDISDPEVILEYSIYPLYIKGKTQLKEKVEEALLEM 80
gi 489013934   5 KLKNKENYKYFVKHYLEVMKEGREAEAFLGEDIRYRFQQRNSMITEYTDIQVLLEYCLFPLYVGGDKDIERRTFEILKEF 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KT6_B        81 SNSGQALDIYQAVQTLNAENMLLNYYESLPFYLNRQSILANITKA---LKDAHIREAMAHYKLGEFA---H---YQDTML 151
gi 488989420  85 SLSIDLVKLDKVTDFISIQNWFLTEYSNLPFTIETDELVRNIIESiskLSDEQKRTYTYERLCNVLD---RsplYRQCDV 161
gi 489134073  81 SVSNDPIQVYQALLFLNSQKLMLRYYETVPFTVDQEPILTNIKVA---LSNEDLKNKMKTYQIGEFA---C---YQDSMF 151
gi 493790316  81 STSNDPIQIYQALLFLNSQNMLLQYYEAVPFIIEQEPILSNIKKAi---DDTALVNKMKTYQVGEFA---Q---YKDSLF 151
gi 827480858  81 SNSGQALDIYQAVQTLNAENMLLNYYESLPFYLNRQSILANITKA---LKDAHIREAMAHYKLGEFA---H---YQDTML 151
gi 447118200  83 ASSQDIIHLYQVVSFIKKQEDLLEEYDSLPFIIDAEAIVPIVLDSiynLPNEKKVNY-YRNICNLID---SmelFKNCDK 158
gi 501962221  83 STSKNVVELYQVVSYIFYQKNNKLLKKDFSFYIDFNPMIPGLVFSvksLSPENIVTDDEKAMVG----------FIKNMF 152
gi 489002879  85 SLSVDLVKLDKVTDYIFIQNRRLRRYTSLPFIIETDELVKNIIESiskLSDGQKKDWLYQGLCNALE---CdpvYRKCDE 161
gi 896606663  85 SLSNDLMKLKKVTQYISNQKWFVTNYYDIPFVIETDELVRNIIEStshLSDDQKRTYTYEGLCNVLE---RnpeYRQCDE 161
gi 489004384  85 SLSIDLVKLDKVTDFISIQNWFLTEYSNLPFTIETDELVRNIIESiskLSDEQKRTYTYERLCNVSD---RsplYRQCDV 161
gi 495364159  81 SKSGKALYIYQVVQFINGENMLLNYYEELPFYLNRDQILSHVKQA---LADDHIRQEMKTYKTGEFA---H---YKDTML 151
gi 489013934  85 SLSIDEKKIWQVTEYLLLQDFILAEYKPLPFEIDTRKLVPLILDTiekLPNELKTSGYYSRLIGNIKsipS---FKSYDV 161
                        170
                 ....*....|
4KT6_B       152 DMVERTIETF 161
gi 488989420 162 EKVEKILKEF 171
gi 489134073 152 DMLERVLLTF 161
gi 493790316 152 DMLERVLQTF 161
gi 827480858 152 DMVERTIETF 161
gi 447118200 159 EKVEYIVNEQ 168
gi 501962221 153 QKIPQVQSYL 162
gi 489002879 162 EKVEKILKEF 171
gi 896606663 162 EKVEKILKEF 171
gi 489004384 162 EKVEKILKEF 171
gi 495364159 152 DMVERIMDTF 161
gi 489013934 162 KKVEKILKEF 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap