4AJ5


Conserved Protein Domain Family
SKA2

?
pfam16740: SKA2 
Click on image for an interactive view with Cn3D
Spindle and kinetochore-associated protein 2
Spindle and kinetochore-associated protein 2 (SKA2) interacts with the N-termini of SKA1 and SKA3 and forms the Ska complex. This is a microtubule binding complex required for chromosome segregation.
Statistics
?
PSSM-Id: 318862
View PSSM: pfam16740
Aligned: 35 rows
Threshold Bit Score: 76.1194
Threshold Setting Gi: 195048201
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4AJ5_K          6 EVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSasE-K-NPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICAT 83
gi 242066802   15 AVSDVLSTLSEASATLADVQRRLDLEFSAAYPDH--A---NPAKLVARVKRVVEEVAVLKEMSRDLLTEKQRLIDQIRVS 89
gi 470242904    8 PIDNVKQIFIESDQELNTIQHQLNHDFYQLYDQS--AsC-NPIKIGERIKRLQDEMVSMMKDIEYIRNTKERMVDRCSTQ 84
gi 159470423    7 SAEELIAALQKGEAMLDQIAHKLEEEAERRFSRA--G-EiNPVLLAKRVRKLASEMPELQAACRDLLSSKQGLVDAAQRQ 83
gi 552835304    8 AAEGLVASLERAQAELEFITNRLEEEFSRKCRNG--E-I-NMLSVLTRLNKLRRELPALQEECQQVLQAKQELVDAVKHG 83
gi 947066545    8 ATDGLLSLFTKANHDLSMVHHRLEKEFQQVYPDNa-----NPMKLVSRIKKVQEDISILKGQCHELLAAKQDLIDKAQRV 82
gi 685366038   11 AVDNLINVFARASRDLDAVHFKLDKEFQQIYPDNa-----NPMKLIQRIKKLQEDVTFLKDQCLELLSAKQDLIDKAQTT 85
gi 1002229233  15 AVNEVLSTLAAANSTLADVQRRLDADFRAAYPDHa-----NPVKLVARLKRIQEEVAAVKGLCRDLLTQKQELIDAMRTS 89
gi 514719261   15 AVNDILSTLADANAALADVQGRLDLEFRASYPDHa-----NPAKLVARLKRVQEEVAALKDLCRDLLTQKQELIDRISVS 89
gi 695058288   18 ALDDVMKVLSRASRDLLLVQRQLDQEFQRSYPDDv-----NPCKIVARIKKIQEDLVSLKELCRELLAEKQDLIDKTRSV 92
                          90       100       110
                  ....*....|....*....|....*....|....
4AJ5_K         84 VKKTMNMIQKLQKQTdlELSPLTKEEKTAAEQFK 117
gi 242066802   90 LMAQRGMTQRLLAAS--GLPPLSDDDEAVLNSLN 121
gi 470242904   85 LINNRTMIQQLRKSTdpTYTQISNEEDYIFSNFK 118
gi 159470423   84 LAANYMRLQQLCAAA--GAPPPDDASFRSFQSsv 115
gi 552835304   84 LVANTEQLRKLQRRA--GIPADAASDETYAAftv 115
gi 947066545   83 LVENRNLVQRMQPSL--GISPSG-EDDAAFTNFK 113
gi 685366038   86 LVGNYNLIQKINASL--GESANGDADDDALADFN 117
gi 1002229233  90 LAVQRSAVQRLLASS--GLPPMSEEDAATDANLN 121
gi 514719261   90 LVSQRGTTQRLLAAS--GLPPLSDADEAAQNSLD 121
gi 695058288   93 LVGQRHSLQMLLASS--GLPSMSESDDMAYANLN 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap