2WX3


Conserved Protein Domain Family
mRNA_decap_C

?
pfam16741: mRNA_decap_C 
Click on image for an interactive view with Cn3D
mRNA-decapping enzyme C-terminus
The C-terminal domain of mRNA-decapping enzyme in Metazoa is responsible for trimerisation.
Statistics
?
PSSM-Id: 318863
View PSSM: pfam16741
Aligned: 24 rows
Threshold Bit Score: 61.9475
Threshold Setting Gi: 91089857
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
2WX3_A         8 SIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHN 50
gi 683926444 704 STSITKMQLQETLLHLIQNDDNFLNIIYEAYLFSVRKAAMKKP 746
gi 556956462 568 PNTLTKGQLQDTLVYLIKNDANFLNIIYEAYLSGVPKEGVKKK 610
gi 129270177 456 SRALSKSQLQTTLLHLIKNDASFLDTIYEAYVSRLTTDSSSKP 498
gi 768944130 578 VPVLSRSQLQATLLSLIKSDSSFLDTIYEAYISRFANSTSSKy 620
gi 637298828 567 lSPLTKLQLQETLLHLIRNDDNFLNIIYDAYVAKSRREDSKKP 609
gi 241705184 362 VTPLTKEQFRDALIFMLQTDNDFLVKIHEAYLGSLKSHFSVDv 404
gi 195431543 334 qppLNSTQFVQAFTYLIQNDKDFANKLHKAYLNGCSNSLIDAN 376
gi 91089857  348 iDLLTEKQLAQALIHLLKTNSNFTRQIHEAYVNSIMERVNCNS 390
gi 449482337 556 STSITKMQLQETLLHLIQNDDNFLNIIYEAYLFSVRKAAMKKP 598
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap