Conserved Protein Domain Family
IL17R_D_N

?
pfam16742: IL17R_D_N 
N-terminus of interleukin 17 receptor D
IL17R_D_N is found in higher eukaryotes. The function of this N-terminal domain is not known.
Statistics
?
PSSM-Id: 318864
View PSSM: pfam16742
Aligned: 7 rows
Threshold Bit Score: 228.933
Threshold Setting Gi: 557009992
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 301621474  47 SRNAGLPNVTFRYDNCTAYMNPGGKHLIGDVQNITISQFACNDQVAVSVLWTANEIGMDYLKGFRVVVEELKSEGRFCQQ 126
gi 557009992  41 KKNTGLPNVTFKYENCTPGASLKGEHAIAEVQSKSVIQYTCEDQAAVTVYWIPNALGIEFLKGFKVILKEIKSDRPQCQY 120
gi 597775691  47 DESGRKL-ITYRNDNCSLNTNLWGKHAIHEVNNITFTHLSCDNQAAVVVHWMASPLGIEHVKGFRVYLEDKNPEEKQCQH 125
gi 548344115  45 adGGRRLAVTFRADNCSLNY-PLGKHMIREVTNVSFSHLACDDQAAVVVHWSASPLGIEHIKGFRVYLEDKNPEGKQCQH 123
gi 972972730  47 EDNSRTAGVTFRNDNCTLNWNPIGKHAIHPVSNVTFTQLPCDNQAAVVVNWYPSPLGIEHVKGFRVYLEDKNPEGKQCQH 126
gi 350591277  56 SRNSGLHNITFRYDNCTTYLSPVGKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQ 135
gi 695138044   6 TKNNGLLNITFKYDNCTPYLNSVGKHVIGDVQNITVNQYACYEQVAVTILWTANTIGIEYLKGFRVILEELKSEGRQCQQ 85
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 301621474 127 MVMKDPKQLNGNYKRVVMETQPFMNLKFETDYFAKIVPFPSV 168
gi 557009992 121 MVLQNPKVLNFSFRETVIKSQSFLNLKFETMYSVRIVPFPSS 162
gi 597775691 126 MILKDPRQLNFSFKNVKVSSQPFVGLAFEMDYMVRIVPFPTF 167
gi 548344115 124 LILKDPRQLNFSYKNTKLSSQPFSGLNFDTDYMVRVVPFPSQ 165
gi 972972730 127 MILKDPRQLNFSFRNVKMSSQPFPGLSFETDYMIRIVPFPSF 168
gi 350591277 136 LILKDPKQLNSSFKRAGMESQPFLNMKFETDYFVKIVPFPSI 177
gi 695138044  86 MVLKDPKQLSPSFKRRGMESQPFVNLKFETDYFVKIVPFPSI 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap