4H8S


Conserved Protein Domain Family
BAR_3

?
pfam16746: BAR_3 
Click on image for an interactive view with Cn3D
BAR domain of APPL family
BAR_12 is the BAR coiled-coil domain at the N-terminus of APPL or adaptor protein containing PH domain, PTB domain, and leucine zipper motif proteins in higher eukaryotes. This BAR domain contains four helices whereas the other classical BAR domains contain only three helices. The first three helices form an antiparallel coiled-coil, while the fourth helix, is unique to APPL1. BAR domains take part in many varied biological processes such as fission of synaptic vesicles, endocytosis, regulation of the actin cytoskeleton, transcriptional repression, cell-cell fusion, apoptosis, secretory vesicle fusion, and tissue differentiation.
Statistics
?
PSSM-Id: 318867
View PSSM: pfam16746
Aligned: 57 rows
Threshold Bit Score: 176.202
Threshold Setting Gi: 313214071
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4H8S_A         30 LLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLAYEKQNfalgKGDEEVI--- 106
gi 321466438    6 LEFTECLTDSPYFRENLQGHEKELEKTSLAIKVLIKEVKDLVNAARALSRAQRSLATSLMSFQFEC----IGNSQTD--- 78
gi 156397101    6 LEFADCLLDSPYFRENVHEHERELERTNEAIKGLIKECKALMKATENLSKAKRSFAQVLDNFRFEC----IGEVETD--- 78
gi 241826931    6 LEFTDCLTDSPYFRENLHAHENELDRTSQAIKGIIKEVKELLTAAKSLSRAQRSLANTFMNFRLEC----IGNSQTD--- 78
gi 198425001    6 LEFSDCFLDSPFFRKSIQEYEDELERTNSQIKQLIKDAKNMLNASRQQGKMMNVFNDRLQNFQFDC----IGENLTDtek 81
gi 393908195    6 LEFADCLSDSPWFRQNLREHESVLEDAHKNIKNIEIQCRELIQCTRKLSVAQKAFAKSLKEFKIVT----IGSTQTDder 81
gi 32565710     6 LEFSDSISDSPWFRQNLHDHEVALDDAFKNIKLIENQCKELIACTKKLSTAQRAFAKTLSEFKFET----VGTNQTD--- 78
gi 968039123   14 LEFEECIVDSPEFRDNLNRHEKELDHTSQQIKRIIKEVKDLMSAAKVLSTRMKQLAILLNDFNFEC----IGTAQTDden 89
gi 357624052    8 LEFTECLADSPHFRENLQRHEKELERTSQQIKRLIKEVKDVVQAAKRLGAAQLALAASMEQFEFAC----IGASMTE--- 80
gi 347972393    7 LEFIDCLIDSPNFRENLNKHEKELDKTSQQIKRIIKEIKDLLAAAKSLSRAQRTLSRSLKEFNFEC----IGSTQTDdeq 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4H8S_A        107 ---S------TLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFREKDLTE-VSTL-KDLFGLASNEHDLSMAKYSRLPK 175
gi 321466438   79 ---DeiviagSLKEFGRLINAIEDERDRMLERAKDQFIGPLENFRKEHIGG-AKEE-KKKFEKQTAKFVQSQERHLNLST 153
gi 156397101   79 ---DeiliaaALKEFAQVIDTVEDERDRMINHANFQLIQPLEQFRKEQIGG-AKEE-KKKFDKQTEKFCIAVQNYLNMSS 153
gi 241826931   79 ---DeiviagSLKEFGRLLTTIEDERDRMLENAHELFIAPIEKFRKDHIGE-AKER-KKKFDKETAKYCQSLERYLGLST 153
gi 198425001   82 giaG------SLKEFGLMLEEVANDWSSTIERSELQLIKPLEDFRKEHIHS-YRSS-KKAFDKASERYYKQLEQTLALSH 153
gi 393908195   82 kiaE------CVSKFGDFITQIEDHREKIIEDSEIHFIEPLRKFRVEGIGK-VLHVdKKRYEKESNKFYASLEKHLHLST 154
gi 32565710    79 ---DerfiatCLKEFGSLINQVEDERMKLVGQAEESYLEPIKKFRTEAIGRtLKEE-KNKYDKESSKFYQTLEKHLHLST 154
gi 968039123   90 vicE------SLKRFGAIIGTIEDEREKMLTLADKHIIESLEDFRKKQIGG-VKEN-KKKFDKKTEKFCQSQERFLNMST 161
gi 357624052   81 ---DervigrSLHHFANLIRTIEDERDRMLGRAHEQIIQPLEKFRKEHIGA-VKEG-KKKFDKKTAKFCQSQERTLSLST 155
gi 347972393   83 viaD------SLKQFSKLISAIEEERDNMLDRAHEQILLPLEEFRKLHIGG-VKEN-KKKYDKKTAKFCQAQERFLNMST 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4H8S_A        176 KKENEKVKtEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFsKRMDSFLSSVADM 255
gi 321466438  154 KKQDSVLQ-EADAILEMEQRHFCQASLEYVYRLQEVHERKKFEFVETLLGFMYGWLTFYHQGYEVS-KEFRPYMTDLQVR 231
gi 156397101  154 KKKEVQLQ-EADAQLQMERRVFHQTALDYVFKLQEVNETKKFQFVETLLSFMYVQMTFFHSGHEAF-KDYMEYMTDLQLR 231
gi 241826931  154 KKGDTQLK-EAFAVLEMEKRHFFKASLEYVLMLQKVQERKKTEFVETILRFMYGWLTFYHQGHEVA-KEFNSFNTDLQVR 231
gi 198425001  154 KKKCQQLQ-ESDNELFTHKKTFHKEALNYVYKLQEVQERKKFEFVEHLLMFMQVYFNFFHQSHETA-NDCKDYMKELQIR 231
gi 393908195  155 ARKN-DFK-EADAQLDMQQRNFCSCSLDYVTAIQAVQERMKFEFVETLCSFVYSWLTFYHVGHVTH-EDFKPFLSEVQSK 231
gi 32565710   155 -VRNNDFR-AADAQLETQQKNFFQASLQYVAEVQSVQERMRFEFVETLGSYVYSWLSFFHVGSVIH-QDFKPFLDNVQTK 231
gi 968039123  162 KKPENTIQ-EADASLGMHEREYIQESLSYVLRIQEVQERIKFEFVEILLAFISGWLVFYHTAHEQA-EDHRDYLQDLRHK 239
gi 357624052  156 KKPEAVFQ-EADAAMDMAERDFCQASLEYVFQLQAVQERKKFELVETLLGFVFGWWTFHHTAHDVH-ADAEPLVRDLQLR 233
gi 347972393  155 KKSSPA----ADASLGMLEREYLRESLSYVLSIQEVQERIKFEFVEIILRFISDWLVFYHLGHEVA-EDAKEYLSDLQLK 229
                         250       260
                  ....*....|....*....|....*.
4H8S_A        256 VQS--IQ---V---E---LEAEAEKM 270
gi 321466438  232 LQK--TR---E---NfntTREEAESL 249
gi 156397101  232 LQN--TRdrfS---A---TKEQAESL 249
gi 241826931  232 LQKasTR---E---NfeaTHCEAEHL 251
gi 198425001  232 LVS--TR---A---QydgTREKTKTL 249
gi 393908195  232 VQK--AK---Q---S---YEETKEyy 246
gi 32565710   232 VQK--TK---E---NynaTNAEAEEL 249
gi 968039123  240 VQK--TRenfE---E---AREKVTEL 257
gi 357624052  234 IQR--TRsnfE---E---TSKQTESL 251
gi 347972393  230 VQK--TR---EnfdE---TRQKAQEL 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap