2L8K


Conserved Protein Domain Family
Arteri_nsp7a

?
pfam16749: Arteri_nsp7a 
Click on image for an interactive view with Cn3D
Arterivirus nonstructural protein 7 alpha
Nonstructural protein 7 alpha is likely to have a role in viral RNA synthesis.
Statistics
?
PSSM-Id: 318870
View PSSM: pfam16749
Aligned: 8 rows
Threshold Bit Score: 147.936
Threshold Setting Gi: 339717327
Created: 30-Jul-2016
Updated: 11-Dec-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2L8K_A          2 LTATLA-ALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFA--VEQEVT 78
gi 952011481 1845 LSTALAcALSEDELNFLAQAVDHKAIVSAIHVHKTLQDYILSKNAKILRASLASVHANHNASKALASLDKFLqgTSTQLK 1924
gi 576938812 1806 LSGALAvNLSAEELEFLNAIVPCKAFASASNLSKAMGDFQQSQAAKQLRRALAGVQATANTTAALATLDQFLstKVRGPR 1885
gi 38230282  1455 LTATLA-ALTDDDFQFLSDVLDCRVVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFA--VEQEVS 1531
gi 429998861 1796 LSACLAtSLSKDELAFVEQLVDCKAVVAAVNTQRALDDYILSTNARRLRSHLTSVHATAAAQRALACLEDFLvgTSKPLK 1875
gi 210077436 2064 LTAALAcKLSQADLDFLSSLTNFKCFVSASNMKNAAGQYIEAAYARALRQELASLVQVDKMKGVLAKLEAFAetATPSLD 2143
gi 25121659     2 LTGALAmRLNDEDLDFLMKWTDFKCFVSASNMRNAAGQFIEAAYAKALRVELAQLVQVDKVRGVLAKLEAFAdtVAPQLS 81
gi 62510951  1896 LTAALAiTLSDDDLEFLQRHSEFKCFVSASNMRNGAKEFIESAYARALRAQLAATDKIKASKSILAKLESFAggVVTKVE 1975
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
2L8K_A         79 AGDRVVVIdGLDRmAHFKD------DLVLVPLTTKVVGGSRCTICDVVKEE 123
gi 952011481 1925 PGDPVILL-GSTS-AELVSvfsgdsEYIAEPIRSHPVAGTICTLCVVQAKC 1973
gi 576938812 1886 TGDTVVYL-GK-PrGEIFDgyvgetQVILKPVRTQSVAGVTCTICEVTVPT 1934
gi 38230282  1532 AGDRVVVIdGLDRmAHFKD------DLVLVPLTTKVVGGSRCTICDVVKEE 1576
gi 429998861 1876 PGDPVILL-GAAP-GTISPaycgdkEYVVRPIRSQTVAGTLCTLCQVEVVV 1924
gi 210077436 2144 TGDVIVLL-GQHPhGSVLDinvgteRKTVSVQETRSLGGSKFSICTVVPNT 2193
gi 25121659    82 PGDIVVAL-GHTPvGSIFDlkvgstKHTLQAIETRVLAGSKMTVARVVDpt 131
gi 62510951  1976 PGDVVVVL-GKKIvGDLVEitindvKHVIRVIETRVMAGTQFSVGTICGDL 2025
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap