Conserved Protein Domain Family
RHH_6

?
pfam16762: RHH_6 
Ribbon-helix-helix domain
This ribbon-helix-helix domain binds to DNA and may be a part of a toxin-antitoxin system.
Statistics
?
PSSM-Id: 318878
View PSSM: pfam16762
Aligned: 11 rows
Threshold Bit Score: 94.4423
Threshold Setting Gi: 504590226
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81598613    2 PTTRWNVAVSTETDQALRMFLASQgGGRKGDLSRFIEEAVRAHILELSAEEAKA-A--NADVSEKDLSAMVEEALDWAKA 78
gi 81548514    2 STVRWNLAVSPDTDQSVRMFLASQgGGRKGDLSRFIEEAVRTYIFERAVEDAKA-A--NANVSEADLTAIVNEAVQWARE 78
gi 499557987   2 PTTRWNVAVSTETDQALRMFLASQgGGRKGDLSRFIEEAVRAHILELSAEEAKA-A--NADVSEKDLSAMVEEALDWAKA 78
gi 505262301   3 DATRWTVNVAPETDIEVRTYLAQR-GMKKGDLSRFIEESVKWRLLDLTLAEARA-G--FDDLSVDELDSLIEEAVADARK 78
gi 504590226   5 DQTRWTVTVSQQTDIALRTFLAQR-GLKKGALSVFIEEAVQRRLRELTLGETRQeA--ERPQDQDRVQDFVDAPLMEAaq 81
gi 302859339   5 GKAEWSVTVSDELNDAVMAYLAKSgQGVEG-LSNLVENAVGKFVKDPRALDKES------DVTEGEISDMINAAVQRTKE 77
gi 503026822   2 DTVRWNLAVSADTDQALRLFLASQgGGRKGDLSRFVEEAVRAHILELTAEQAKA-A--NAEVNEDDLSAMVDEALNWARQ 78
gi 506247910   5 ETTRLTVTFSRETDLALRAFLGAQ-GMRKGDLSKFIEDAVRWRMFDQAVQGVKA-R--NADVDVGDLQAAIDEACAAVRS 80
gi 524144885   9 SNVKWNISVPPDFDEATRIYLASH-GGKKGALSSLVQKAVSRYIISSLAEEAKE-EvrTSGLSQDDLDKIIADGVMWAKE 86
gi 489179616   2 NTIRWNVAVSADTDQSLRMFLASQgGGRKGDLSRFIEEAVRAHILELSAEQAKA-A--NAHLSEAELTNAVDEALDWARK 78
gi 500119791   2 NTVRWNIAVSPDVDQSVRMFIAAQgGGRKGDLSRFIEEAVRAYLFERAVEQAKA-A--TAGMGEAELNDLIDEAVQWARE 78
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap