3LR2,2MX8


Conserved Protein Domain Family
Spidroin_N

?
pfam16763: Spidroin_N 
Click on image for an interactive view with Cn3D
Major ampullate spidroin 1, spider silk protein 1, N-term
Spidroin is produced by a number of arachnids. Spidrions are made up of repetitive segments flanked by conserved non-repetitive domains, and this domain is the conserved non-repetitive region. Aggregation to form the rigid silk occurs due to association at the repetitive regions, and the N-terminal domain is necessary to prevent premature aggregation during storage before extrusion. This N_terminal region inhibits precocious aggregation and then accelerates and directs self-assembly as the pH is lowered along the extrusion duct.
Statistics
?
PSSM-Id: 318879
View PSSM: pfam16763
Aligned: 23 rows
Threshold Bit Score: 120.097
Threshold Setting Gi: 303307766
Created: 18-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3LR2_A          9 PWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLaaqGRTSPNKLQALNMAFASSMAEIAASEEGGG 88
gi 121960138   33 IFNSPNAATSFLNCLRSNIESSPAFPFQEQADLDSIAEVILSDVSSV---NTASSATSLALSTALASSLAELLVTESAEE 109
gi 122122920   35 VFSSPSLASGFLGCLTTGIGLSPAFPFQEQQDLDDLAKVILSAVTSNt--DTSKSARAQALSTALASSLADLLISESSGS 112
gi 121987310   30 VFSSPNLASGFLQCLTFGIGNSPAFPTQEQQDLDAIAQVILNAVSSNt--GATASARAQALSTALASSLTDLLIAESAES 107
gi 303307754   32 PFANKIMAEDFMNKFTNQLANSPYFSSQQKEDMSSIKDELISVIESMdsaHKSSAAKLQAMNMAFASAIADIAATEAYGA 111
gi 122091488   28 PWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLaaqGRTSPNKLQALNMAFASSMAEIAASEEGGG 107
gi 303307758   23 PWETPEMAENFMNNVRENLEASRIFPDELMKDMEAITNTMIAAVDGLeaqHRSSYASLQAMNTAFASSMAQLFATEQ--- 99
gi 303307781   39 IFGNPNTANNFVDCLKGGIQASPAFPRQEQADIQSIASSILSAgn----tATKSKAIEQALSTALASSLAEIVITESGGQ 114
2MX8_A          8 IWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMg--PNPPQHRLRAMNTAMAAEVAEVVATSPPQ- 84
gi 303307775   18 VWSSPQMAENFMNGFSMALSQAGAFSGQEMKDFDDVRDIMNSAMDKMirsGKSGRGAMRAMNAAFGSAIAEIVAANGGK- 96
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
3LR2_A         89 SLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMN 133
gi 121960138  110 DIDNQVVALSTILSQCFVETTGSPNPAFVASVKSLLGVLSQSASN 154
gi 122122920  113 SYQTQISALTNILSDCFVTTTGSNNPAFVSRVQTLIGVLSQSSSN 157
gi 121987310  108 NYSNQLSELTGILSDCFIQTTGSDNPAFVSRIQSLISVLSQNADT 152
gi 303307754  112 DISLETSAIANALSEAFLQTTGVVNKRFISEIQELIYMFAQDASv 156
gi 122091488  108 SLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMN 152
gi 303307758  100 -DYVDTEVIAGAIGKAYQQITGYENPHLASEVTRLIQLFREEDdl 143
gi 303307781  115 DYSKQITDLNGILSNCFIQTTGVENKRFVNSIQNLIRLLAESAVS 159
2MX8_A         85 SYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSAN 129
gi 303307775   97 --EYQIGAVLDAVTNTLLQLTGNADNGFLNEISRLITLFSSVEAN 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap