4DHX


Conserved Protein Domain Family
CID_GANP

?
pfam16766: CID_GANP 
Click on image for an interactive view with Cn3D
Binding region of GANP to ENY2
CID is a domain on higher eukaryotic germinal-cent associated nuclear protein, or GANP, that binds to the transcription and mRNA export factor ENY2. The complex of these two proteins forms part of the TREX-2 complex that links transcription with nuclear messenger RNA export.
Statistics
?
PSSM-Id: 318881
View PSSM: pfam16766
Aligned: 15 rows
Threshold Bit Score: 85.0681
Threshold Setting Gi: 551529422
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
4DHX_A          4 VLSELSQGLAVELMERVMMEFVRETCSQELKNAVETDQRVRVARCCEDVCAHLVDLFLVEEIFQTAKETLQ 74
gi 620983886  706 VITQLSQALVEDLTEVIVKECVRETSSRELKCAVEIDQRARVARCSEDVCVRLMDLFLEDEIFQSAKETLQ 776
gi 821485737  476 LLAHLSQVLAAELMDLVVAECVRETSSRELKSAVETERRARVARCSEDVWDRLMELFLAEEIFQSARETLQ 546
gi 637250429 1138 LIKTLSESMSANLTDEIINEMIQEISTMELRCAREKDQKARIARCSKEVCAEIMGTFLEDEIFQSAKETLQ 1208
gi 556983195 1357 FITRYSQALCKQLAEEVLAESVKDIANTELQCAVEEDRTIRITICSEEVSDSLLDQTLEEEIFQTGKETLQ 1427
gi 512867406 1535 LLDQISLSQCKDLLKEVLTDSIYNISAEELKHAVQLDKNARISRCSEKVCDEYLSQFLEVEIFELARDSLH 1605
gi 573898015 1352 LIAQISKALCEEIAKEVLKECIEATAACEIKQALE-EKAACVARCSEDACNTLIEETLESEISKLANDILt 1421
gi 551529422 1089 FLAQFSCSLCSEVVQQVVAEVVRETAAAEIQVAVA-EQAERLARCSDQICSSLIEETLAADVAQLAEDVLE 1158
gi 971404254  981 LIKRLSQLVSMELMEEVINETVQEASANELKCALERDQQARIARCSEEVCGHVMDLFLEDEIFQIAKETIQ 1051
gi 565312800 1143 I---LSKSLGAELLEEVIKQGIKEISVKELKCAVEIDQKARIVRCSQEICTKMMDVFLEDEIFQNAKETLQ 1210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap