4EAE


Conserved Protein Domain Family
DUF5068

?
pfam16781: DUF5068 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF5068)
This family is expressed by Firmicutes. The function is not known.
Statistics
?
PSSM-Id: 318893
View PSSM: pfam16781
Aligned: 3 rows
Threshold Bit Score: 212.525
Threshold Setting Gi: 81509589
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4EAE_B         7 SFSPSGFKVS---TVESilGGDVTTTYLSSSKSFQKDFEALTLFINQYKVEHVINPTKEVsaSNPesYLANKNGYVITLD 83
gi 89084867   49 GTSAEGELLNpniADES--EGEVEVIYTNTDPGFVHDMKGFKVSVDEYQIVKVTDMHEDV--TIP--FNDEIDGYVITAK 122
gi 504463295  60 ASSGSGEVLNpniAVES--EGNVEVVYTNKAPGYTHNMNGFKVSVDEYQIVKVTGMNKRVa-SIP--FQDQTDGYVVTAK 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4EAE_B        84 ISIKNNSKKDKXYkaDQISLLGASKSVggsldNFIPSG--FHLI--------GSSSDPYNFTAGKTARGLLTFTXDEATY 153
gi 89084867  123 VTVDNGTDKAMYY--NNMHRIQTSHEL-----DWYPSD--PTFIldadkvksKKESETGKFAAGEKITGLISFTLTNAEF 193
gi 504463295 135 VTIDNAAGKAMYY--NNMYRIQLSKAT-----DYIPNDgsATFVrkedrlksKQETETSKFAAGEKVTGLLSFTLTNEQF 207
                        170       180       190
                 ....*....|....*....|....*....|....*..
4EAE_B       154 NDLAKDSQIGVPDPSRFDSSSTKGSSQDNVVAPFPIK 190
gi 89084867  194 DKLSTVKPKYIIEGGAADNDQFKGSIQGNAVFDFAYS 230
gi 504463295 208 ESLKTVKPKFVIEDGAADNSEAKDSFKGNAVFDFFYS 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap