4DRB


Conserved Protein Domain Family
FANCM-MHF_bd

?
pfam16783: FANCM-MHF_bd 
Click on image for an interactive view with Cn3D
FANCM to MHF binding domain
FANCM-MHF_bd is a structured region on Fanconi anaemia complementation group protein M that binds to a two-histone-fold-containing protein complex MHF. MHF binds double-strand DNA, stimulates the DNA-binding activity of FANCM, and contributes to the targeting of FANCM to chromatin.
Statistics
?
PSSM-Id: 318895
View PSSM: pfam16783
Aligned: 25 rows
Threshold Bit Score: 171.417
Threshold Setting Gi: 78099255
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DRB_C          16 KKDWFLSEEEFKLWNRLYRLRDSDEi-kEITLPQVQFSSLQneE----NKpAQESTTGIHQLSLSEWRLWQDHPLPTHQV 90
17_pfamImport    1 TSNGFLSSTEYSLWESTMKLEDTEP---HPSLKQSHFLSIPsdPl--pQEeVSKGKQPSRELSLWEWRHWQHKALPSHVV 75
11_pfamImport    1 ASDGFLSSVEYSVWETTMKLGEHEGflsFISVFRYSFLSRNqkN----EEnADKHKHPHRELSLWEWRHWQHKALPSHLV 76
18_pfamImport    1 TSDGFLSRAEYSLWSSTMRLEEHEA---HPTLKLSHFMSIPsdStpqkKEaTSRDKPPSRELSLWEWRHWQHKLLPFHAV 77
7_pfamImport     1 KSDGFLTSAEYSLWASTMRLEEDEA---HPTLKPSRFMCLPddAsp------qVPFFCRCYLSLWEWRHWQHKALPTHDV 71
gi 972978594   733 KDGGLLSPEELSLWNSSLRLEEEEP---QPTLPRSHFLSLKseP----PSpECVPTSSSRELSLWEWRCWQNRLFPTAMV 805
gi 260836711   670 KDDGFLTAQELAVWNERYKLSAEEEk-aVPILQPARFVHLKd--------tGTRDQPRRPSLSLTEWSIWQNRLQPTHLI 740
gi 597791740   725 KDDGFLSPAEQAEWASTMKLPEDEP---QFKLRESSFLFLGgdP----QLhESSVHSEVRHLSLWEWRHWQNQPLPTHRV 797
gi 241568989   650 KEGGVLTRQEQLYYEAHFEVAESAIp-tVPTVSTS-FVTLRgaT----TPeSDKTAPRRPALSLSSWTPWQNSFQPTLRV 723
gi 779993596   738 ADDVFLTYEELAFWNLHYKVDQEELl-kAP--QRTQFLSLN--K----QAvQEVSSSNDKELSLNSFAEWQTNKQPIHKV 808
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|..
4DRB_C          91 DHSDRCRHFIGLMQMIEGMRHEE-G-ECSYELEVESYLQMED 130
17_pfamImport   76 DHSLRCSHFIKVMELIDCMREEN-EgECCYERELLPYLHKED 116
11_pfamImport   77 DHSLRCRHFVQVMELIDGMKDEN-E-NRSFSIDNETFILQED 116
18_pfamImport   78 DHSLRCRHFSAVMQLIDGMRDES-E-VSKHQFEVLLYF---- 113
7_pfamImport    72 DHSLRCHHFVKVMELVDVMREEN-EgECRYEQELLPYRHK-- 110
gi 972978594   806 DHSDRCRHFSQIMELIDCMRQEEkG-ECNYELELMPYLKKED 846
gi 260836711   741 GHSQRCKNFVELMEFIDLQKDAG-D-EDSYGMEMKAFLNNDD 780
gi 597791740   798 EHSSRCLHFTAIMDLTDRMKLEE-EvDFRYESDLVSYQSKED 838
gi 241568989   724 SHSRKTDDYVHVMQFIENLRLTD-DrMDAYGLEMKTFLRMED 764
gi 779993596   809 SHSRRCDVFVEMMEFLEIQGHTE-D-EDIYGAEMVLYLDEGD 848
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap