3K29


Conserved Protein Domain Family
YscO-like

?
pfam16789: YscO-like 
Click on image for an interactive view with Cn3D
YscO-like protein
This family of proteins is similar to the type III secretion protein YscO. The family includes Chlamydia trachomatis CT670 which is found in a type III secretion gene cluster. CT670 interacts with CT671, a putative YscP homolog and CT670 and CT671 may form a chaperone-effector pair.
Statistics
?
PSSM-Id: 318899
View PSSM: pfam16789
Aligned: 6 rows
Threshold Bit Score: 128.428
Threshold Setting Gi: 297377132
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K29_A         3 VRYPLEPVLSIKKDRVDRAEKVVKEKRRLLELEQEKLRERESERDKVKNHYXQKIRQ-LREQLDDGTTSDAILKXKAYIK 81
gi 122389372   2 PPYRLQALQDMRARAKEEAEQAFSSAIKALEKEKAELQRLIDDLEQRKRERKAKVAAyLKEVMFKGAGINGMNMMNRFEE 81
gi 503690370   4 VVYPLQQVLQVKQRRVEDAERVVADKKLALEREKETLAKRKAERDKVLEHLKAKMDQ-MRYEMDHGTTSPKILQMKVYIK 82
gi 499871784   2 PPYRLQALQDMRARAKEEAEQAFSSAIKALEKEKAELQRLIDDLEQRKRERKAKVAAyLKEVMFKGAGINGMNMMNRFEE 81
gi 297377132   4 PEYPLEKVMDIKKKRVDEAEKVVAAKKRELEAEREKLRKCEEERDKAVQHKIDKLNQ-LRDELDRGTTTDKIQQMKNYLK 82
gi 503710269   4 PQYPLEQLVRIKKRRLEEAEKVLKQKKEELEQEKKKQEELEEARNETFRHKQDKMTQ-LRDEMDRGTTSDKIKIAREYIK 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K29_A        82 VVAIQLSEEEEKVNKQKENVLAASKELERAEVELTKRRKEEEKTRLHKEEWXKEALKEEARQEEKEQDEXGQLLHQLHKQ 161
gi 122389372  82 RLKDEEAQVALEVERQREAVKVAERLVEQRRREMAEAAKELKAIEKHRENWQKQVKYERQQREELNQEEIGNALFLARQR 161
gi 503690370  83 IVQERLKVEEKKVADQKEQVTVAEKNLEIAKEELKRKRQEVDKLMTHRKDWLQELKKEEEIIEGREQDELGSVMYMIHQR 162
gi 499871784  82 RLKDEEAQVALEVERQREAVKVAERLVEQRRREMAEAAKELKAIEKHRENWQKQVKYERQQREELNQEEIGNALFLARQR 161
gi 297377132  83 VVEERILVEEKKVQEQEEQVNIAKRNLEIAQEELKMRRQEVDKLQNHKKDWIKQMKRELELAEEREMDEIGQVLYLRNMR 162
gi 503710269  83 VVDEELKQKEKKVQDQIKKVEEARQKVEEARKDLVKKQQDIEKLNMHRKEWDKEMKALEEHQMAIETDEIGSAMHNIRKL 162

                 .
3K29_A       162 K 162
gi 122389372 162 K 162
gi 503690370 163 K 163
gi 499871784 162 K 162
gi 297377132 163 D 163
gi 503710269 163 K 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap