3QH6


Conserved Protein Domain Family
DUF5070

?
pfam16802: DUF5070 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF5070)
Statistics
?
PSSM-Id: 318910
View PSSM: pfam16802
Aligned: 3 rows
Threshold Bit Score: 297.729
Threshold Setting Gi: 81345108
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3QH6_A        3 MRAVLHLEHKRYFQNHGHILFEGLAPVSDCKQLEAELKLFLKEVAVVKDRHLQRWRENVHRTLPGVQMIVKRVRLDHLAA 82
gi 81345108   1 MRAVLHLEHKRYFQNHGHILFEGLAPVSDCKQLEAELKLFLKEVAVVKDRHLQRWRENVHRTLPEVQMIVKRVRLDHLAA 80
gi 81345108   1 MRAVLHLEHKRYFQNHGHILFEGLAPVSDCKQLEAELKLFLKEVAVVKDRHLQRWRENVHRTLPEVQMIVKRVRLDHLAA 80
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
3QH6_A       83 ELTHRSRVALVRDLWVQKQEEILFDDCDCSVLLCLSGEKAGWGLFFSGEYPQDVFDWGAGDTAIILRFSSAGFP 156
gi 81345108  81 ELTHRSRVALVRDLWVQKQEEIFFDDCDCSVLLCLSGEKAGWGLFFSGEYPQDVFNWGAGDTAIILRFSSAGFP 154
gi 81345108  81 ELTHRSRVALVRDLWVQKQEEIFFDDCDCSVLLCLSGEKAGWGLFFSGEYPQDVFNWGAGDTAIILRFSSAGFP 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap