3HGF


Conserved Protein Domain Family
NBD94

?
pfam16830: NBD94 
Click on image for an interactive view with Cn3D
Nucleotide-Binding Domain 94 of RH
NBD94 is a domain on one of the reticulocyte binding protein homolog family or RH proteins expressed by the malaria parasite merozoite. RH proteins recognize erythrocytes and are important in virulence. This domain has been shown to exhibit selective binding to ATP and ADP. Binding of ATP or ADP induces nucleotide-dependent structural changes in the C-terminal hinge-region of NBD94 that directly impact on the ability of the RH to bind to the red blood cells.
Statistics
?
PSSM-Id: 318929
View PSSM: pfam16830
Aligned: 8 rows
Threshold Bit Score: 79.4077
Threshold Setting Gi: 371925138
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3HGF_A         13 EKKIENIVTKIDK--KKYIYDNMKKLLNEIAEIEKDKTSLEEVKNINMSYGKSLNKLFLEKIDEEKKKSENMIKSMEKYI 90
gi 74991908   358 EEKIKNIVTKIDE--KKNIYNKINKLLDEISEIEKDNTSLEKVKDINLSYGKSLGKLFLDQIDEEKRKAEYMIKTMEAYI 435
gi 74990930   224 EKKIKNIVTKIDK--KKTIYEEINKLLNEISKIETDKTSADEVKDINVSYGTSLSTLFLGKIDEEKKKAENTIKSIETYI 301
gi 74881184   265 ENKQETIVSKIDK--TKSIYENMNKLVSEITEIKNNTISLKNIQNINLSYKQSLNKLFGDQINKEKTNSENMIKSIEKCK 342
gi 74978126     8 EKKTKNIVTKIDN--KKNIYDNMKKLLNEIAEIEKDKTSLEEVKNINMSYGKSLNKLFLDKIDEEKKKSENMIESMEKYI 85
gi 901885455 1187 KNKTAEFNAKKDS--LEKIHQQMENTHKELESMENEKIPINDINQMEIEYARILIHHMVQQIGEKKERSKIILEEIKTTI 1264
gi 74878987   469 EKKIENIVEKIDK--KKNIYKEIDKLLNEISKIENDKTSLEKLKNINLSYGKSLGNLFLQQIDEEKKKAEHTIKAMEAYI 546
gi 371925138  130 QEKDKQIVYNTNRgdIEKVYKNIRDMYNELDDVEKGETTSNEVDNIEMQYDRLLINLLVQKINEENTKAKGLMEEIKSYI 209
                          90
                  ....*....|...
3HGF_A         91 KDLDEIKEQSPKA 103
gi 74991908   436 DDLDNIKNKSQEI 448
gi 74990930   302 ENFDIIKKKSNEM 314
gi 74881184   343 TEFDDIKNKLIAE 355
gi 74978126    86 KNIDEIKKQSPKA 98
gi 901885455 1265 ASIDQAKKNIPPE 1277
gi 74878987   547 DDLDNIKKKSQEI 559
gi 371925138  210 ENIESVQAKMSDE 222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap