5FB4


Conserved Protein Domain Family
Caud_tail_N

?
pfam16838: Caud_tail_N 
Click on image for an interactive view with Cn3D
Caudoviral major tail protein N-terminus
This is the N-terminal domain of the major tail protein, or knob protein, from Caudovirales.
Statistics
?
PSSM-Id: 318937
View PSSM: pfam16838
Aligned: 3 rows
Threshold Bit Score: 165.202
Threshold Setting Gi: 75086385
Created: 19-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5FB4_A        7 SGTNVRILADVPFSnDYKNTRWFTSSSNQYNWF----NSKSRVYEMSKVTFMgfrENKPYVSVSLPIDKLYSASYIMFQn 82
gi 75086385   3 KLTNFKFFYNTPFT-DYQNTIHFNSNKERDDYFlngrHFKSLDYSKQPYNFI---RDRMEINVDMQWHDAQGINYMTFL- 77
gi 138123     7 SGTNVRILADVPFSnDYKNTRWFTSSSNQYNWF----NRKSRVYEMSKVTFMgfrENKPYVSVSLPIDKLYSASYIMFQn 82
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
5FB4_A       83 ADYGNKWFYAFVTELEFKNSAVTYVHFEIDVLQTWMfDIK 122
gi 75086385  78 SDFEDRRYYAFVNQIEYVNDVVVKIYFVIDTIMTYT-QGN 116
gi 138123    83 ADYGNKWFYAFVTELEFKNSAVTYVHFEIDVLQTWMfDMK 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap