Conserved Protein Domain Family
Stomagen

?
pfam16851: Stomagen 
Stomagen
Stomagen (epidermal patterning factor-like protein 9) acts as a positive regulator of stomatal development.
Statistics
?
PSSM-Id: 318947
View PSSM: pfam16851
Aligned: 7 rows
Threshold Bit Score: 77.6133
Threshold Setting Gi: 302764960
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 302764960   10 DRRAMVGSTAP-SCTYNECRDCKT-ECRAEQVPLNGRNPKESAYRYLCVCR 58
gi 922549590   52 SRRHMIGSTAP-TCTYNECRGCRY-KCRAEQVPVEGNDPINSAYHYRCVCH 100
gi 695050065  252 TRRLMIGSTAP-TCTYNECKGCRL-KCRAEQVPVDAGDPMNSAYRYRCVCH 300
gi 548853853   73 ARRLMIGSTKP-TCTYNECRGCKTnKCRAEQIPVDANDPLNSAYHYRCVCH 122
gi 1002290036  81 ARRMAIGSRAP-TCTYNECRGCRR-RCSVQEVPVDAGDPMNSAYHYRCICH 129
gi 944238243   38 gRRMLVGSRAPtTCTYNECRGCRH-RCSVQVVPIDASDPINSAYHYKCVCH 87
gi 573915116   74 ARRMLIGSTAP-ICTYNECRGCRF-KCTAEQVPVDANDPMNSAYHYKCVCH 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap