4QHW


Conserved Protein Domain Family
DUF5077

?
pfam16871: DUF5077 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF5077)
This family is found at the N-terminal of DUF3472, pfam00958.
Statistics
?
PSSM-Id: 318963
View PSSM: pfam16871
Aligned: 28 rows
Threshold Bit Score: 205.178
Threshold Setting Gi: 302764536
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4QHW_A         12 GNGY-VT--R-QQDGARITQRGVTHWTNPKSIVSIYFYLHQPTTADLSLYAK---GHSEIKVSYGKKGFKVNLQSNDFTK 84
gi 1032340086  37 GNAW-TYn------GGKISEQGFSDWENTSTICRTYFKTSQQGTLKLSIIINtngSKSKLKVSIQGKSIEIIAENNTEKE 109
gi 503695026   45 GNAW-LLn-A--ASTEKITKEGLTQWTNPQTVCRTYVRISQPGQLKLSVTLTaseGT-VYQTTLMGKTLSFTASSEGLNE 119
gi 504493871   45 GNSW-ITn-NlTGNKAQIDENGLSNWQSKESIVSTYVFAPKAGEITVALNLKvlkGSSKIKVEVAGTSTILEAKNSSYDM 122
gi 740746154   50 GNSW-VIdnT-SMDQQVISDSGITQWNNSNSIIRTYFKTDSIGELKLGLKAKt-tNQATLKITLGKTSKEITLNNKKYTT 126
gi 740770320   45 GNSWfVTn-V-GGNQVKTDDFKNFSWSTKYSVLRTYFRVESAGSIHIGVNAKvssGSSTLKATFLNETTELVFDNTTNRM 122
gi 390418190   41 GNTY-QV--L-GLVSEPISQNGISNWTDNNTVYNVFVKTTGAQSIGVILNIEnqpDQATIKVKIGETEKEVTIENNTSGE 116
gi 503430984   38 GNSW-QTgtT-SGKDNLISKAGIKQWDDPKKGFKTFVRLEKVGTLTIWLDAKin-ePSALQVTVAGETKTVNLKAQHKKM 114
gi 503532711  166 GNTF-FSn-F-GASGIELSIQGIQNWTGATVVPTVYVRFLEKGTYTLNIVAKaa-qQSTINVGIQSKNVKVAVNSPDWKK 241
gi 502837337   29 GNSW-IKnsP-EKTKALVFDTGIHNWTSTDDILQTYFATSQSGNLQIGLSVKvpeGLTDIQVLLDGNVRELKLSNATYKD 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4QHW_A         85 VPVGSIDIRQAGYVRIDLQGVSKSGEgfGEIKQLIADN--VTGKSNYV----KDFSD---YWGRRGPSVHLGYALP-EG- 153
gi 1032340086 110 VYVGEWNIRKAGYIAVDMSGITKTTNtfGQISNLIVSGsaISEDLAFV----KNNDGnffYWGRRGPSVHLRYPVE-SSq 184
gi 503695026  120 YFVGEWNIKKAGYLPIDLQGITKKGAtfGSVQSISLSGsaVSTETVFV----KDNTDnyfYWGRRGPSVHLKYTLP-PNe 194
gi 504493871  123 RKVGTFVLKKAGYFAIRLQGISKTGKcfADVSSIAISGmpVESGAVYT----QDNKDnyfYWGRRGPSVHLNYEVP-EKi 197
gi 740746154  127 IDIGTFNITQPGYHYIELEGIEKTGNvyADISEVLIGGsiTEKNITYV----PNDf----HFGRRGPSVHLKYEAP-QNi 197
gi 740770320  123 EFVGSFTVSEPGYYYLDLQGVDKTADqfATVESVSLGGdaCKSGVHFS----NEDy---fYWGRRGPSVHLGYTVPaEAs 195
gi 390418190  117 IKVGDFEFKQ-GYEKIELTGVSKTGDnfVKIKDIILEHs-gDINAEYV----KNNGDnnfYWGRRGPSVHLGYQVP-EGk 189
gi 503430984  115 VYLGDWVIRDTGYTVINIHG---RPVnlSNIEYLGIHGtaVNDRVHFV----KNDEGnffYWGRRGPSTHLNYQLP-Ek- 185
gi 503532711  242 YPLGSFTL-EAGYLPIVLNGLIRTGTkfADIQAIEIQGdpA--KIKFVdatlTGSAQdsyYFGRRGPSVHMSYTLP-AGk 317
gi 502837337  107 IGVAEFEEVASGYHTLELKAKHKTGNyvADVQEILLGGsvASSEVTFI----KESEn--fYFGRRGPSDHLNFTIP-EDk 179
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
4QHW_A        154 --DTEWFYNEITVPKEGETXHSYYXAAGFGEGYFGXQYNS 191
gi 1032340086 185 --EVEWFYNEITVPKGNDVIGSYFMANGFGEGYFGMQVNS 222
gi 503695026  195 --DIEWFYNELTIPEGQDVIGSYFMANGFAEGYFGIQVNS 232
gi 504493871  198 sqQIEWFYNEITIPKGKDPIGSYFMANGFKEGYFGIQVNS 237
gi 740746154  198 --DAVYFYNEITVPKDEDIIGSYYMANGFGEGYFGIQVNS 235
gi 740770320  196 --DVVYFYNEVTVPEGNDVIGSYYMANGFGQGYFGMQVNS 233
gi 390418190  190 --DYQWFYNEMTIPEGEDPLGSYFMANGFAEGYFGIQVNS 227
gi 503430984  186 --DIMYYYNEVTVPEGNDLIGSYFMANGFSGGYFGMQVNS 223
gi 503532711  318 --NIEWFYNEVTVPSGNDVIGSYFMVNGFAEGYCGIQVNS 355
gi 502837337  180 --ELLYFYSEIEVPQGQDKIGSYFTADGFNYGYFGIQVNS 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap