Conserved Protein Domain Family
AbiGii_2

?
pfam16873: AbiGii_2 
Putative abortive phage resistance protein AbiGii toxin
AbiGii is a family of putative type IV toxin-antitoxin system toxins. The AbiG abortive phage resistance protein affects lactococcal bacteriophages phiP335 and phiQ30 but not the other P335 phage species. AbiGii toxin appears to confer resistance to phages by a mechanism of abortive infection that acts by interfering with phage RNA synthesis. The cognate anti-toxin is found in pfam10899.
Statistics
?
PSSM-Id: 318965
View PSSM: pfam16873
Aligned: 5 rows
Threshold Bit Score: 413.807
Threshold Setting Gi: 17366546
Created: 14-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17366546    2 AKSKFKTTFS--NDKAtTSSTALLKYINKKAPKGYKYEILYKGSdiYSLKKDNt-dEKISF-LVRFKFPLNFEGIKVTNP 77
gi 752605993   4 MFANFNKAFRknPLKT-KVPSEVLAALSHKLPDGFKYVNIGEGA--CGIASDY---MHLKF-NVKIPEGAIKNKDYIKTA 76
gi 446380025   1 MFANFKKAFKkdESDT-KIPKAILDAMSDSLPSGLKYTQMDKGY--CAIIPEKg-eLKFKFeNLKIKIP---KNIKLTTA 73
gi 489104005   2 INSKFQSVFSksDSKKiKAPRALKKHLNENAPKGYSYELLEGSKdiYVLRPKSn-kEKNSF-QIRIKFPLIFEGIEIKSI 79
gi 446414551   1 MFSNFKQAFKkdESTTsNIPQAVLDALSEELPKGLKYVPLDNHH--IQAVPKEgeeIKITIsNLKIKLP---NGLKLNSP 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17366546   78 QDLLELSYRTQK--EIVLDE---TLQNGSDGQPPTLVSL-KGE-VGK-Q----SIFPIPFPKLDPIKLEW--FGGALEIP 143
gi 752605993  77 NDLANYIYRTQQelEVIPDKdgcILINDNKFSFSDLLHFpLEEkYIKsQga-fVIKPEPFPDPFPIEFEA--NGAKKVIL 153
gi 446380025  74 EELTEFLYRTQQvvETETDV---VTINDHKIKLSDFVKHpFKEkTFE-KgskfSIQPESFGEPFPLKVEHenGQIAKEFL 149
gi 489104005  80 EELLEAMYRTQK--CFKLDE---ELQND----PPTIIHI-GGDkILN-Qf---IASTEEFPELPSLKIKV--GGNEVEVP 143
gi 446414551  76 DELQEFLYRTQQtvQTDGEN---IKINGETKPITELVKKpFQPqKNI-Igk-yDIIPEPFPEPKPLEVVYeeKGITEVFH 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17366546  144 IKRIPYASLSEIKLESESDNILHVSFLFNETNNKVHLNTNINFEYLRTIDDYFKFRDFLKNYSEGRVKILSKNItlRSED 223
gi 752605993 154 IQRQPYDSIYETLFKSVNDDCLQISYLINERDFSLKLTINISLEKAKTIKEIVTASKLYYGFLNGTLKMGEFPL--NQKP 231
gi 446380025 150 IERKPLADMHKSLFKSINEDVLEITYTLDEQHHNLKFNVNVDLQKAKTVLEIIEAFNIYIAFIEGKIKIEGLLL--NPVP 227
gi 489104005 144 IKRIPYPSLDELKIVSDKNSLFKVEMLINESSSVMELTVNLNYDIIETVDQYFDNFGYISSFNKEGVTIFGKVF----LP 219
gi 446414551 151 IKREPLADMKKSLFKTVDNGPLELILTLDEEVNTIAINVNLMLSKAIDIEEIIAAIKLYIGFLNGKIKLAGGIQ--TPIM 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17366546  224 NNDKIK-IFEKNDKLYNALRLIQSKIDTKIPFPQNLSIKDVNIIKILFESYINDRvvKFKSEPSLKFTFDDSSNFKESFP 302
gi 752605993 232 DEKVDE-DFSKTIEFWEKVLAVENTLGIVFIPTSRIQHDDGYWIECLYRTLVLKQ--PYRENIKMSTVKMRNVSFTQEGG 308
gi 446380025 228 IEKERV-AAGAALDYWQTVQAVAEKLDVQFKPDEGEGAVNAEWIAKLYRSFVEKK--AYKQRSGTASFITGSKGDWDEKK 304
gi 489104005 220 EKHQTN-VFEKNNEFLNALRKLQEYFGIKFNFPHELEKDDIYYTQILFESFVNNRmvSIGNNDQVSFLFEKEKFDFSNPY 298
gi 446414551 229 NETDAKgSIEDALRYWEKVSAISEKLHVKFNPQEEIDEEGLLLIDRLYKSLIENL--PYKMPVTVNNFTTTTSEALNKSE 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17366546  303 ITGKKNMGIFVPFQRNIKFLSVSIPIIENQLYTDTTVKTA---DLQDRVLILETNKNNESFVFy--QNSEEYKEIS-INE 376
gi 752605993 309 FKKKSGMVFEYLREIAGELLGAKINLIEFSIIYNFIITNAtkvDKSENDYDVQIEPDGKEGIY---RSTQYFKTKDeADV 385
gi 446380025 305 LLEKDAMALQYTLNEGIKVYGVDIPLYSAVALLNCKVESVipvEGLDRKYEFKVIPADEKGIY---QAARHFSTKEaFDE 381
gi 489104005 299 LEKDKELGVVLHNELSLELFGTNIKIMEYKVYPRMNFEKIi-tENEEVRVIFNLPPNSRYYIRyypDAICEDETKEiDNL 377
gi 446414551 307 FLNGNGMAFQYTNTESFTLYGAKFNIFSAVALLNCKINSIetvE--TNKYKFNIEPSYGDSII---QASKHFITKEeLDK 381
                        410
                 ....*....|....*.
gi 17366546  377 MLEKKKAAIEL----D 388
gi 752605993 386 FRTVHIKNHEIfkkaE 401
gi 446380025 382 VFKNMGEVLEElskaE 397
gi 489104005 378 LFELTKTAIEIerinf 393
gi 446414551 382 FFTPPSSALEAlskaE 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap