Conserved Protein Domain Family
DUF5078

?
pfam16877: DUF5078 
Domain of unknown function (DUF5078)
This family of unknown function is found in Mycobacterium spp.
Statistics
?
PSSM-Id: 318969
View PSSM: pfam16877
Aligned: 13 rows
Threshold Bit Score: 187.647
Threshold Setting Gi: 502904436
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81536793   34 TEDFPIPRRQIATTCDAEQYLAAVRDTSPIYYQRYMIDMHNKPTDIQQAAVNRIHWFYSLSP---TDRRQYSEDTATNVY 110
gi 499211323  34 TEDFPIPRRQIATTCDAEQYLAAVRDTSPIYYQRYMIDMHNKPTDIQQAAVNRIHWFYSLSP---TDRRQYSEDTATNVY 110
gi 433296558  41 TDDYPIPHRMIVTTCTSEQILAAARDYAPIYYQRYIIDKHNKSPEVQQAAIDNAHYFYSLSP---ADRRAYSEEMVTH-F 116
gi 491230702  40 TDDYPVPRRMLKTTCTAEQYLAAVRDYDPIYYTRYMIDKNNKPQQVQDATIDRIHQFFAKDY---AGRREESEVFAVNYP 116
gi 502903369  31 TDEYPIPRKMLLTTCTAEQLLDAAKYETPMEFDRYMMEYKKHGEDLEDRTKERMHWFFSLPPgvqGPRRDFSEHMAAT-F 109
gi 738508369  33 TDDFPIPRRIIATSCDAEQVLAATRDTSPVYYQRYMIDYNNHP-EFQQATQDKAHWFFSLSP---ADRRDYSEH-----F 103
gi 565995399  27 TDEYPIPSKILKTPCTAEQILAATRDTNPVYYERYMIDYNNKSPEVHRAVQDRIHWFFAMDY---AGRRQYSEDTATNaF 103
gi 518341537  25 TEDYPIPRRMLHTTCTAEQILAAARDVEPVYYERYMTDYNNKSPEVQRAVRDRIHWFYSMDY---SGRRAYSENTATNaF 101
gi 503978957  28 TDEYPIPNRLMRTTCTVDQYMAAARDQDPMYYERYMIDYRNRPADVQTGARNRIYWFFSLDY---AGRRQYSENTATNvY 104
gi 500104391  34 TEDYPIPRRIIHTTCDVEQYMAAARDTSPVYYERYMLDRSNRPLDVQQAAFDRIHWFFSLDP---VGRRQYSENTATNiY 110
gi 502904436  45 TEEYPVPKVMLLTTCTPDQMLAVVKRTDPREFARWMTEYKVHSQEIQLSAQVWARAFFSMEPgvrGPRRDVSERIAGT-F 123
gi 565996265  36 TDDYPIPHRQIETHCDAEQYLAAARDTSPIYFERYMIDKANRPPEIQQMAVDRIHWFYSLDA---AGRRQYSEDTATNiY 112
gi 500048391  35 TDDYPIPNRIMRTPCTAEQIMAAARDVEPVYYERYMTDYKNKPPHVQQAARDRIHWFFSMDY---AGRRQYSENTATDaF 111
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 81536793  111 Y---EQMATHWGNWAKIFFNNKGVVAKATEVCNQYQAGDMSVWNW 152
gi 499211323 111 Y---EQMATHWGNWAKIFFNNKGVVAKATEVCNQYQAGDMSVWNW 152
gi 433296558 117 A---DPMTASWPNWAKVFFNNKGVAAKETDHCADYPPDDMSVWDG 158
gi 491230702 117 P---EALTSQWPNWGKIFFNNKGVVAKGTENCSKYP-SDMSVWDG 157
gi 502903369 110 G---DPLDVLYTDYAKIFVNNKGVVAKMAENCAKYPRDDQSAWDW 151
gi 738508369 104 YdsiDPLWWGWRNHMKIFFNNKGVVAKSTEVCNQYPAGDMSVWNW 148
gi 565995399 104 Y---EQLAWNWPNWAKIFFNNKGVVAASTAVCQNYPPDDMSVWVW 145
gi 518341537 102 Y---EQLSWNWPNWAKIFFNNKGVAAHTTDICANYAPEDTSVWVW 143
gi 503978957 105 Y---EQMATRWGNWAKLFFNNKGVVAHATDVCMNYPPSDPSVWTW 146
gi 500104391 111 Y---EQVATRWGNWAKLFFNNKGVVAHATDVCMNYPRGDMSVWNW 152
gi 502904436 124 G---DPTDLMYADHAKIFFSNHAIARRMTEQCKDYPKDDPSVWDW 165
gi 565996265 113 Y---EQVATRWGNWAKIFFNNKGVVAKATDVCAGYPAADMSVWNW 154
gi 500048391 112 F---EQLAWMWPNWAKLFFNNKGVAANTTDVCEQYPPDDMSVWNW 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap