Conserved Protein Domain Family
DUF5083

?
pfam16890: DUF5083 
Domain of unknown function (DUF5083)
This protein is believed to be involved in the type VII secretion system.
Statistics
?
PSSM-Id: 318980
View PSSM: pfam16890
Aligned: 2 rows
Threshold Bit Score: 256.049
Threshold Setting Gi: 446333511
Created: 7-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446333514   1 MEKIKRINKIFLSFEVIPFAMMILLAFPPIIASLINNRLQYGRDFGDRVSFYCYISIMVAYAITILLEIIFYFILLKNYQ 80
gi 446333511   1 MEKIKRINKIFLSFEVIPFAMMILLAFLPVIAGIINNRLQYGRDFGDRVSFYCYISIMVAYAITILLEIIFYFILLKNYQ 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 446333514  81 YDQNNIELANRVKVTKVLSILYMIPGLYAIACYFRFIHVRSFRENKKSGQPAYHFWEFFIKPNRKPIELKDFFIKNR 157
gi 446333511  81 YDQNNIELANRVKVTKVLSILYMIPGLYAIACYFRFIHVRSFRENKKSGQPAYHFWEFFIKPNRKPIELKDFFIKNR 157
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap