Conserved Protein Domain Family
DUF5085

?
pfam16895: DUF5085 
Domain of unknown function (DUF5085)
This protein is believed to be involved in the type VII secretion system.
Statistics
?
PSSM-Id: 318985
View PSSM: pfam16895
Aligned: 7 rows
Threshold Bit Score: 151.446
Threshold Setting Gi: 446373920
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 488372327  10 MLKHVAYKTYFDVTESD-FESVFLNFNKLLERKGVIAKSPLHFAVTQVDLHKNSNIEVFIAVNKPFES-CEELQYRTYFY 87
gi 257276733   1 MMKNVAYKTYFDVTMDD-YEDILKDFTNLAISKGKTITGPLTFAVTQIDLQKRMNIDLFISVGKCFKS-NEELSYRTYFC 78
gi 488403239  10 RLKNVAYQSYIDIPIGQ-IEAYVIKFVEACYEEDVQIDNRLIMAITQLTLDRHINVTFYAPISRAILP-SSVLNFRSFLI 87
gi 446504862   9 AYTNVVSKEYY-FHYED-MEEAIEHFMSEIATANLTVKGPMFYALKNIPSDENMYVELFMPVNEDKIPaSETLQFRSYYY 86
gi 488129514   9 AFQNVVSREYF-FHYTD-MEKVIEDLLAEIAQANLTVKGPMFYALKNVPSDGDMFIELFMPVHESSIPiSETMKFRSYYY 86
gi 446504863   9 AYTNVVSKEYY-FHYED-MEEAIEHFMSEIATANLTVKGPMFYALKNIPSDENMYVELFMPVNEDKIPtSETLQFRSYYY 86
gi 446373920   6 LIMPFCVKITFEIDKNDnWLNALDTVNEFFMDKDIYPTGPIIFQRELAGLGEYKY-TAYIALNDELQD-IPELNIK---Y 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 488372327  88 INNLLQG-RITSNNFVKDE-IELLNEMQTFAKENNLTFIS-PYYHIFktNYKNEKAWVEVKAKVYE 150
gi 257276733  79 LDNMLHG-RITSNNFITDE-IALLEDMNEFASDNNLTFTS-PYYHTMrkSFSGEQGWIDVKAKVYE 141
gi 488403239  88 IEDMIQG-RIRSKQFELEE-QQLIDEFNDFCKEYDYQIVS-PYYHIF--QLENNKAWIDVKAKVME 148
gi 446504862  87 VDEMLMK-RYTG-DYEKLT-EQVYGEMLLYMEDNNLNLAS-PIYHVF--SGDESLQYVEVKIAVFN 146
gi 488129514  87 VDNMLMK-RYAG-DFERLT-EYAYAEMLQYMEDNELDMIS-PIYHIF--SGDEELQYVEVKIAVDT 146
gi 446504863  87 VDEMLMK-RYTG-DYEKLT-EQVYGEMLLYMEDNNLNLAS-PIYHVF--SGDESLQYVEVKIAVFN 146
gi 446373920  81 IDCLEVGpTLSTKCFEEEEfERAYKEIEYVANENNIKILNqPYYHVMvdYFGGTAFEIYAQVDLDE 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap