3C24


Conserved Protein Domain Family
PGDH_C

?
pfam16896: PGDH_C 
Click on image for an interactive view with Cn3D
Phosphogluconate dehydrogenase (decarboxylating) C-term
PGDH_C is the C-terminal domain of putative bacterial phosphogluconate dehydrogenase proteins.
Statistics
?
PSSM-Id: 318986
View PSSM: pfam16896
Aligned: 17 rows
Threshold Bit Score: 211.791
Threshold Setting Gi: 503350440
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C24_A       131 DETDPAARTDYHGGI-AKQAIVCALXQGPEEHYAIGADICETXWSPVTRTHRVTTEQLAILEPGLSEXVAXPFVETXVHA 209
gi 81646052  125 DRFTPEEHADAFGGVaAPQHVAASYETGSDEQKATLARVVKVMYGPVIDVHWVTVKQLAYLEPTLVETVACMVGTLMKEA 204
gi 81529092  131 ERTTKEEWQDTFGGIaAPQEVVAAYEGGDAAKQELADSVIRVMYAPVVDVHWVTVKQLAVLEPTLVETIACMVGALLTEA 210
gi 501018118 125 KELNQDALNDHFGGLhAKQSVVSTLLQGPDSAWELGEDIAKTIYAPIKNSYRVTLHQMAMLEPGLSETVCATLLTAMRQA 204
gi 503695221 121 WEEDKKRHFDYFGGItAHQAIVCALMQGPEEHYPIGEELAKTMYAPVTRAHRITVEQMAILEPGLAETFLGAVMFTMREA 200
gi 503529640 122 WEPTEAAFRDFYGGVsAKQSIVVALMAGSEAHYALGEKVSQDMYAPVDQTYRITLEQMAILEPAMVETLAQTCMEVVREG 201
gi 501796646 125 DEETPEARRDHWGGI-APQSIVCTLLQGPEEHYQPCEQLAKEIFAPIRAAYRLNIHQMALLEPILSEAIAYTLLSVLRDA 203
gi 503350440 128 ERTTKEEWADTFGGIaAAQDAIAAIESDDPEKKAIVEATVRAIYAPVIDVHWVTVKQLAQLEPTLVETVACMIGALLNEA 207
gi 506281700 124 QRKTPEEVADTFGGIaAAQDVVAAIESGDEAARAVAAEVIRTMYAPVIDVHWVTVKQLAYLEPTLVETVACMVGALLKEA 203
gi 494665647 122 DETDPAAKRDFFGGVhARQHIVCALMQGPEEHYALGEAIARTIYKPVMRSHRCTVEHIAILEPALSETVGATLSLALREA 201
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
3C24_A       210 VDECADRyGIDRQAALDFXIGHLNVEIAXWFGys-pKV--PSDAALRLXEFAKDIVVKEDW-REALNPAKVKQAAELI 283
gi 81646052  205 LDETINTiGVPEAAAKAMLYGHIQIALAVAFR----STnpFSDACMIAIEYGKENIIKPDW-KKIFDEKELDLVIAKM 277
gi 81529092  211 LHETVHTvGVPEKAARAMLLGHTQVALANTLK----GSnpFSDACLIAMDYGRESIVREDW-KKVFDDEELDKVITRM 283
gi 501018118 205 MDEVVDG-GVPYDCARDFLLGHMNILAAVIFDei-dGQ--FSDACNKAIDNGLGKLLHPDW-KKVFNKDELAHSIQLI 277
gi 503695221 201 MDEVIKM-GVPKEAVFDFFMGHINIDLALCFDqipgGV--FSDACYKAIQIGKPLIFKEDW-KKVLDPEHVKYQVKIM 274
gi 503529640 202 YDRIITL-GVPEAAARDFVLGHLRIQIAVLFKev-nGT--FSDAAYKISKRAKPILFRDNW-QKIFEMDDIREQVRDI 274
gi 501796646 204 YHEAVAR-GIPEPAVRDFLLGHIRVELAILFGei-qWR--PSDAAERVRMWTYPRLIKENW-RRLFDDDQLHECVQII 276
gi 503350440 208 LDEAIHTmGVPEAAARSILYGHTQVALANGLR----GDnpFSDACLIAMDYGRESIIKDDW-KKIFRDDELDKNLARM 280
gi 506281700 204 LEETVNTvGVPEPAARAMLLGHVQVALANTLK----GDnpFSDACLIAMDYGRETIVKDDW-KKIFNDGELDAVIAKM 276
gi 494665647 202 TDEAVRR-GVPRQAAEDFILGHLTIELAIAFGifpeGK--FSDGALKAIDEARPVIFRDNWlETVFSPEEVKRSVRAI 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap