4D0I,4D0I,2GTL


Conserved Protein Domain Family
Eryth_link_C

?
pfam16915: Eryth_link_C 
Click on image for an interactive view with Cn3D
Annelid erythrocruorin linker subunit C-terminus
This domain is found in linker subunits of the erythrocruorin respiratory complex in annelid worms.
Statistics
?
PSSM-Id: 319001
View PSSM: pfam16915
Aligned: 16 rows
Threshold Bit Score: 116.677
Threshold Setting Gi: 122124761
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4D0I_0       119 ITHVGSSYTGLA-TWTSCEDLNPDHAIVTITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTT-QLRGFYNFGKRELLLA 196
gi 122121785 119 PFAKGDTFVGDQ-EFDHCGRFNPDHITLHIDSVTTIPFFTSHPKVTGRVDIHVDRDDDWAVST-PSFGFYSFATHRIIFR 196
gi 122124762 136 LTEAGSSWTGTV-VYDHCTKRRPETMKLSIKSVDTVPFFTTHPKVRGTVLMEKHTKDYSEVINePVSGYWSSADRSAAMP 214
gi 121253    132 AASVGSSFEGQIrQLDTCTKRKPSAFRFIITNVDVPKYFPQEPHVKATILMTSSKDGHETQSSlAVDGVYDFTHRKVILY 211
gi 74797517  113 FLAPGTQFSLRL-SWTSCENWADKHYDVHLRQLHRSKTFAGNADVVVDLVSQDHQH------RlVLKGRYTYGKKELLLL 185
gi 74824652  119 ITHVGSSYTGLA-TWTSCEDLNPDHAIVTITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTT-QLRGFYNFGKRELLLA 196
gi 122124761 112 PAHAGATFKGVIlNSQCQTENVAKNMQIDIVGEKRYSDFPTISVLELLVTLDDHQD--------LYNGIYSYGRKALVSF 183
gi 74822960  125 PVPAGRSWNGVA-HWDSCLVRSNNKMNVLITGNKRYDYFPSRLWVDAVIIESYTVSGEEQTNTwSISGFYNYASRMVKFN 203
gi 158263370   1 HTPAGSSWGGDL-EWVGCAAHRSKRVYIVITRTWQKSYIPSIQMVAATLVFSWVEDGKTMTNTeQVEGHYCCGAHALKLR 79
4D0I_2       119 PTKAGDKFIGDV-CFDHCTKRRPEHMTLAFESSSIAAFFTPIADLHVHIEIESETDEDESEVSmPADGEYSFADHRLTIH 197
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
4D0I_0       197 PLKGQseGYGVICDFNLGDDDHADCKIVVPSSLFVCA-HFNAQR 239
gi 122121785 197 TPDKD--SLYLVAQFDGYNFDRFVGETLRVGTGLPCA-RFIYKR 237
gi 122124762 215 PDSAG--HLGFVCIFHGHDHDTCTGLLTKGKVTDACA-EFTFHR 255
gi 121253    212 SPDKD--NLIFECTFPRHDNNHCKG-VMKHSGGDVCL-TFTLER 251
gi 74797517  186 SDHPKlkGYQFVCDFFDGKKGRAKCYIETKSSLFPCGtGFLLEK 229
gi 74824652  197 PLKGQseGYGVICDFNLGDDDHADCKIVVPSSLFVCA-HFNAQR 239
gi 122124761 184 GKGGG--GLGMVCYFDTDDGKFCKAEFLSIVSKEVCG-TAILTS 224
gi 74822960  204 SPKEGtmGIGLTCSDAGSDVAQC--DFVRATDQHVCG-SVTLTR 244
gi 158263370  80 AANGHv-GADITCNFT--DDNHCHGKIYKAATGTLCS-RVILTR 119
4D0I_2       198 PPEED--GLGLVGEFDGYNFDRFVGHIVHELSEEVCA-EFIFHR 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap