2PZI


Conserved Protein Domain Family
PknG_TPR

?
pfam16918: PknG_TPR 
Click on image for an interactive view with Cn3D
Protein kinase G tetratricopeptide repeat
This domain is found at the C-terminus of protein kinase G and contains a tetratricopeptide repeat (TPR).
Statistics
?
PSSM-Id: 319004
View PSSM: pfam16918
Aligned: 18 rows
Threshold Bit Score: 350.106
Threshold Setting Gi: 502613620
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2PZI_A        340 PGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAA-R 418
gi 81822822   430 PQLSTVFSPQRAGFGTEELISQTDAYADGAGRDPRLSAADVAAALPIPLIDPGEPAAALLAAAMQPDPARALDALGEA-R 508
gi 1027696152 341 PGMSTYFGPPRGVFGVDVAV-------D---------AAKIIAALPVPLVDPTDSAAALLATTGGTTPAELERSFEAG-L 403
gi 505121720  409 PRMSRYFSPQRGIYGAG-----IDVVVDP---------EGVIAALPVPVVDPTDPGAAVLATTSGTPAAQLEHALNLA-R 473
gi 504721090  440 AAASVLFGPENYTGGAETGTRDVDRVL-----AP-PSPTEASALLPAPLIDQSDPAAQLLRGFAGMPATELIPTLRSA-T 512
gi 527105750  428 PGLSLVFSRQRTSFGTDELVGQTDVYVDGVSHDAALDPREVAHALPIPLVDPTDPSAPLLAAAVHSEPSQTLDALKHA-R 506
gi 504794629  419 PQTSAVFGSPRGDFGIEALIRQTEGVIEGVHAAPTLEPASVIAALPVPLIDSEDPSAELLSPLLHGDSQQALDTLRQSaA 498
gi 504115660  437 PQASTEFGSMRGDFGIDTLIGQTDGMVDGMHRMLSVEADSVVAALPIPLIDSEDPSAELLATLLHGDPRHILDVLERT-T 515
gi 491661144  399 PYLSTVFGRQRATFGADEFVEQTDVFADGVERERKLNPRNVAQSLAVPLVDTDDPGAALVNATAHSDPQLMLDVLDRA-R 477
gi 374848863  495 PQLSTVFSPQRAGFGTEELLGQTDAYADGIPRSTKLAAREVALALPVPIVDPADPSAPLLSAAVHPDPEHALEALDDA-R 573
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2PZI_A        419 H-GA-LDAD-GVD-FSES--VELPLMEVRALLDLGDVAKATRKLDDLaerVGWRWRLVWYRAVAELLTGDYDSATKHFTE 492
gi 81822822   509 A-RAeADPD-TAP-DTLG--VELTLAEVRIRLDMGDAAAALRLLARL---DAGDWRVHWYTGLAELREQHYESAFAAFED 580
gi 1027696152 404 R-SV-VTGR------GES--AEIPLRLIRAALEVGDSAEADRRLTAAagtLWGDWRLTWYRGQSRLLAGDLAEAAIEFEA 473
gi 505121720  474 S-GA-QQAN-R-----SS--IEVPLRLVRASLEIGAPENARKRLTELeavIPGDWRLSWYGGQCALLEHAFDKAAADFEA 543
gi 504721090  513 E-------------LT----PETLLALTRALLAVGDHGAALDVLQRFsttIPGDWRTMWYLAVAELSMGRFHEARDHFDE 575
gi 527105750  507 E-NG-IDRTsGTPaAAIS--GEVRLAEAKAHLDLGDPETALSVLDELqqsIGDHWKIEWYRGLAALQLDRFEPAFSHFET 582
gi 504794629  499 D-MS-AGVI-GTP-ATFE--LEGTLTAVRAHLDLGEVEQARQYLTQLtpaHRADWRIQWYTAIADLSCAEYVLAHAHFDR 572
gi 504115660  516 E--R-IGAG-TIK-APESfdLEGPLTAVRAHLDLGEVATARALLDRLrprYGGDWRLQWYSGIADLLDGQYESASACFDE 590
gi 491661144  478 D-SP---ER-G---VPDS--LELKLAEIRAHLDLGDAGKARQLLRALapaYPFEWRIDWYRGIAALLSDELTTAYASFDA 547
gi 374848863  574 ErAA-ADPD-NAP-PNLD--VELRLAEARVHLDRGEPAAVAHVLAGIp-aTARDWRVDWYTGLAELVELDFETAFARFDA 647
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2PZI_A        493 VLDTFPGELAPKLALAATAEL-----A----G---N---TD----E-----------H----K-----F-------YQTV 526
gi 81822822   581 VLRVLPGEIAPKLALAATAEL-----VlqhwE---T---AD----Peqwr----syaE----K-----Y-------YETV 625
gi 1027696152 474 VYAGLPGEAAPKLALAAVAEL-----S----GaaaT---TDfaaaQ-----------H----QrraalY-------YETV 519
gi 505121720  544 VLAALPGELAPKMAIAATAEL-----R----G---D---RGa---A-----------A----R-----Y-------YQTV 578
gi 504721090  576 LYAHLPGESAPKLGLAIACER-----T----G---E---HEi---A-----------A----R-----Q-------YATV 610
gi 527105750  583 VLTALSGEAAPKLALAATAEL-----Ilq-hW---E---SD----Dpdqw---crfsE----K-----Y-------YRTV 627
gi 504794629  573 VHAMVPGEIAPLLALAATAELvlqssAa--tG---D---QD----R----------------------WrqqaterYRSV 618
gi 504115660  591 VHTVLPGEIAPALALAATAEL-----V----L---QhleTP----Eesd------rwHsaamE-----Y-------HRMV 636
gi 491661144  548 VYSAMPGEVSPKLALAATAEL-----L----L---E---HH----SesgtdrwrlpsR----E-----Y-------YRTV 592
gi 374848863  648 VLNVLPGEIAPKLALAATAEL-----VlqhwD---S---PD----Peqwr----ayaE----K-----F-------YATV 692
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2PZI_A        527 WSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALP-P- 604
gi 81822822   626 WRTDRAVVSAAFGLARQLAAAGRVDTAVRALDEVPAASRAYTTARLTAVWLLLTAAPIDELPESTLHVAAARVQTLP-A- 703
gi 1027696152 520 WRTDRGYLSAVFGLARLRTAAGDRDGAVAALDQVDAGSVLFTEAGIAAVRTVLHDRAPAELTEPILRDAGERITRLRlD- 598
gi 505121720  579 WRTDRSYVSAAFGLARQRVHAGDSAGAVAALDQVPNDSAHFTPAGATAIEILLEGRTPDKLDEQILLDAGKRAEALN-Ie 657
gi 504721090  611 WSTDHSYVSAAFGLARIRIAQGDRASALRVLDTVPELSSLYVRAQ-TALISLLATE---DGDGTDLIRAGERLERLG-L- 684
gi 527105750  628 WRTERNYVSAAFGLARQLADHGNKKAAIAALDEVPTSSRHYNVARMSSALTMLSGVPIAELDESTLREAARRVRALP-A- 705
gi 504794629  619 WRNTRGVASAAFGLARGLAAAGDVDAAVSTLQQVPDSSRHHNTARMTAC-LLSATRPVADLTRADLDAAVAHVHALP--- 694
gi 504115660  637 WRTNHGVVSAAFGLARRLAADGELLEAVGVLDQVPAASRHHAVARMTGCLLLV-SRPVGEIIAEDLREAAERLEALP--- 712
gi 491661144  593 WRIDRNVVTAAFGLARRLAADGDVNAAVTALDQVPPGSRNYGAARMTAVLTYLSVRPIGAIDEATLRESARRVEALP-R- 670
gi 374848863  693 WRTDHGVVSAAFGLSRQLTAAGRVDDAVHALDEVPATSRYFTTARMTAVLLLLTAAPPAELDETTLHFAAARVQALP-S- 770
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2PZI_A        605 TEPRVLQIRALVLGGALDWLK-DN---K---ASTN---H--ILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMA 672
gi 81822822   704 GEARALQLRVLVLGAALAWLR-AGhepE---RADA---T--FFGAPFTERDLREGTEAGLRALARAAPGRDHRYALVDLA 774
gi 1027696152 599 SRRRSAEIRLRVQAAALDWLQ-AG---G---VPSE---HgrLLGVPLDQDGVRAGLERCYRDLAHETDDMWERFALVEQA 668
gi 505121720  658 SATKRALIRLRVLEAALNWVGaGH---K---SSTG---W--LLGAAFDEPRIRSGMERSYRELAHETPDMWDRIALVEKA 726
gi 504721090  685 DGESTDRLAVRVLESALAWLE-EG---Gd-pPPDG---L--LLGGPFTSRGVRTDLERRYRSLAHRSGRLAERYRLVDRA 754
gi 527105750  706 EESRSLQMRTLVLGTALDWIR-YG---NrshTELE---P--ILDLPFTEQGLRTGAEACLRALARATTSRTHRYALVDRA 776
gi 504794629  695 DDPRLTQLRAIVLGAALSWVQ-AGg-hP---EPRT---T--ILGCPFTEAGLRGGLESALRAVARTTPSRLHRYALIDLA 764
gi 504115660  713 EEPRTLQLQVIVVGAALEWLR-AG---H---TVPEpgaT--LLGFPFTEPGLARGLEACLRALARTAPDRLHRYRLVDLA 783
gi 491661144  671 TEIRGPQMRTVVLGTALEWIL-SG---NtptTAHE---P--LLGVPFTERGLRAGTEASLRAMARSAPTPTHRYTLVDLA 741
gi 374848863  771 AEHRAVQLRLLVLGTALAWLQ-AGhtpK---RPDA---T--LLGEPFTERDLRDGTEAVLRTLARISPNRTHRYALVDLA 841

                  ....*..
2PZI_A        673 NKVRPTS 679
gi 81822822   775 NSIRAKT 781
gi 1027696152 669 NTIRPRT 675
gi 505121720  727 NKIRPRS 733
gi 504721090  755 NSRRPVT 761
gi 527105750  777 NAVRPRS 783
gi 504794629  765 NDIRPRS 771
gi 504115660  784 NHVRPHS 790
gi 491661144  742 NAVRPQS 748
gi 374848863  842 NAIRAQT 848
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap