Conserved Protein Domain Family
Tic110

?
pfam16940: Tic110 
Chloroplast envelope transporter
Tic110 is a family of chloroplast envelope proteins. Some are involved in protein translocation and others are neurotransmitter receptor, cys loop, ligand-gated ion channel or LIC proteins.
Statistics
?
PSSM-Id: 319019
View PSSM: pfam16940
Aligned: 13 rows
Threshold Bit Score: 637.903
Threshold Setting Gi: 552815218
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75157412    78 TGLQPIVEKMTPPVRLATSAVVLAASLATGYGLGLRL-AGSRNIAFGGAAVAGAAGGAVVYALNSAVP------EVAAIS 150
gi 302766595   79 SGPKKLLEGMPAPTRYVTCTAIVAGALMAGYAVGSQA-KGTPNAALAGAIALGAVGGATAFVVNSMAP------DVAAAQ 151
gi 255079196   66 qleaqqsalgqarlgaygvvvggalavgaaagtatgsnaakavltaglgagaavavatadkkrVSAAP------KALWNG 139
gi 302851714   72 DSGQQLLSSIPL---MLLYPGFLAAVAAAGYGGSLLGrAAPVDPSAKDVAAYGTAAVAAAAVAYGCVQakrkrdSAAVVD 148
gi 552815218   61 prdmdglqsalaglptagvyvlgaalaaglggagfvgagavapegvrqaarvvagaagaalgafltaqlkakrqsAAIIE 140
gi 460402942   72 SPIQSLVDAMSPpirIASSALIFAAAIAAGYGLGLRF-GGSRNAGLGGAIAFGAAGAGAAYALNSCApq------vaAIN 144
gi 359478503   71 SGIQPLVDSLSPplrLVSSALIVAGAIAAGYGLGFRF-GKSRNTALGGAVAIGAAGGAAAYALNACVpe------vaAAN 143
gi 586712470   72 SGVQKLVDSMPSsvrYVSSVVIVAGALASGYGLGMKV-KGTRAAAIGGAVALGAAGGAVAYALNSCVpd------vaAAN 144
gi 695070198   83 SGPQALVCALPPparMASSAVLAAAAMAAGFGLGLRV-GGSKVAGIGGAAVLGVAGGAAVYALNSKVpe------vaAIS 155
gi 721659745   89 TGVQPLVESLPPaarTAAELAVAAAAVAAGYGIGLRLgGGSRAAAVAGAAVLGAASVAGAAAVNSVVpe------vaAVG 162
gi 566201416   68 SGAQSIVSNLSPtlrLASSALILAGALAAGYGLGTKFgGGSRNLALGGGAVAGAAVGAVVFSLNSAVpe------iaAIN 141
gi 356565914   55 CGIEHLVDKLSPpvrLATSVVVFAAAASAGYGLGSKL-GGCQNVAIGGAVAFGVAGTAAAYALNAVApq------vaAVN 127
gi 356553146   61 KGIELLVDKLSPparLATSAVIVAGAAAAGYGLGSRF-GGSRYAALGGAVALGAAGGAAAYALNAAApq------vaAVN 133
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75157412   151 LHNYVAEFEDPASVTKDDVEKIADRYGVNKGDEAFQAEICDIYCRYVTSVLPTEGQSLKGDEVAKIVKFKNALGIDEPDA 230
gi 302766595  152 VHNLLVNHPDPRSLRGEEIEGILKKFGINKTNEKFNTELRNLYDSFVSSVIPPGNEDLKGDEAATIRKFKEALGLDDPDA 231
gi 255079196  140 MLN-----RDPATITKADVDAIGAKFGMKDMSKDCPEAVTELYDAYLQSIVPMGDDPVQGWEPEALRNFRQQLGLEDADA 214
gi 302851714  149 LYNALVDLPDATDLTPETVSDVGSKYGINFQKDELD-GLKRIYGQYLESVIPVGDVQLKGDEAAKVAAFKDILGLADEDA 227
gi 552815218  141 LSNLLVEMGDPTALTREQVAAIEAKYGASLAATNPD-ELKSIYGAFLEAVVPPGDAPLTGSEPVLIQAFKAALALSDVDA 219
gi 460402942  145 LHNYVADFDNPAALNKEDIESIANKYGVSKQNEAFNaELRDIYCRYISAVLPASTEELRGDEVDTIIKFKNALGIDDPDA 224
gi 359478503  144 LHNYVAGCDDPGAVKKEDIEEIANKYGVSKQDEAFNaELCDLYCRFVTSVVPPGSEDLKGDEVDTIIKFKSSLGIDDPDA 223
gi 586712470  145 LHNMVVRSGDPRSLEKEAVDEIANRYGVSRQNEAFNaELCDLYSRFVSSVLPPGGENLRGDEVDSIIQFKNSLGIEDPDA 224
gi 695070198  156 LHNLVAGYDDPTELRKDEVAAIVEKYGVSKQDDAFKaELCDLYSRFVSSVLPPGSENLKGYEVEMIIRFKEALGIDDPDA 235
gi 721659745  163 LHNYVVGCDDPTKLETSEVEAIASKYGVSTQDAAFKaELCDLYASFLYSVLPPGDEDLKGNEVEVITKFKSALGLDDVDA 242
gi 566201416  142 LHNYVSGFDDPTKVSKEEIEGIAKKYGVSKQDEAFNaELCDLYCQFVSSVLPPGGEELRGNEVDTIINFKNALGMDDPDA 221
gi 356565914  128 LHNYVVGLDNPFLLKKEDIDGISNRYGVSKQDDAFKaEICDIYSHFVSSLLPPGDVELKGDEADKIISFKNSLGIDDPDA 207
gi 356553146  134 LHNYVAAFDDPSKLKKEEIEAIASKYGVSKQDEAFKaEICDIYSEFVSSVLPPGGEELKGDEVDRIVSFKNSLGIDDPDA 213
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75157412   231 AAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGD-A-SSFLLPWKRVLKVTDAQ-------VEIAIRENA 301
gi 302766595  232 AAVHIEICRRIVRQRLETGDRDTAVEELRAFQKLVYVSNLVFGE-A-SKFLLPWKRVFKVTDSQ-------VEIAVRDNA 302
gi 255079196  215 ANAHIEVGRRLFRKRIELGDKDADLESRREFQKLVFISTRTFGEkQ-AKFLLPWNRIFRVSDAQ-------VTLAMKESA 286
gi 302851714  228 APVHIEVGRRFMREGFETKDRNAVFEKRKAFQRLIYVSQVVFGD-QkAAFLLPWRRTFNLNDAQ-------IFVARRDNA 299
gi 552815218  220 APAHIEVGRRILRGRMEAGSRADDVEARKTFQKLIYVSNLVFGDrQ-AAFLLPWTRVFGLTEAQasarlscVYVAKRDNA 298
gi 460402942  225 ADMHMEIGRRIFRQRLETGDRDGDMEQRRAFQKLIYVSTLVFGE-S-SAFLLPWKRVFKVTDAQ-------VDVAVRDNA 295
gi 359478503  224 AAMHMEIGRRIFRQRLETGDRDGDIEQRRAFQKLVYVSTLVFGE-A-SKFLLPWKRVFRVTDSQ-------VEVAVRDNA 294
gi 586712470  225 ASVHMEIGRHIFRQRLETGDRDADIEQRRAFQKLVYVSTLVFGE-A-STFLLPWKRVFKITDAQ-------VEVAIRDNA 295
gi 695070198  236 ASVHVEIGRHIYRQRLETGDREADIEQRRAFQKLIYVSTLVFGE-A-SKFLLPWKRLFNVTDSQ-------IEIAIRDNA 306
gi 721659745  243 ANMHMEIGRRLYRERLETRDRDADMEQRRAFQKLIYVSNLVFGD-A-SAFLLPWKRLFGITDSQ-------IDIAMRDNA 313
gi 566201416  222 ASMHVELGRRIFRQRLETGDPDGDVEQRRAFQKLIYVSTLVFGE-A-SSFLLPWKRVFKVTDSQ-------VEIAIRDNA 292
gi 356565914  208 AAMHIEVGRNIFRQRLEVGDCEADIEQYRAFQKLIYMSYLVFGE-A-SSFLLPWKHVFKVTDSQ-------VEEAIRDNA 278
gi 356553146  214 ASMHMEIGRKIFRQRLEVGDRDADVEQRRAFQKLIYVSNLVFGD-A-SSFLLPWKRVFKVTDSQ-------IEVAVRDNA 284
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75157412   302 KQLYAERLKLVG--------RDINVENLVDLRKSQLSFKLSDELAEDLFREHTRKVVVENISSALSILKSRTRa------ 367
gi 302766595  303 QRLFATKLSSIGtgkyssyrTYVNIDQLKELRRIQLKVQLSDEITSSLFKSHTQKLLEGYISRALEVLKARTR------- 375
gi 255079196  287 SNLFKNHVNESGa------iNTLEAGALAAARAYQQELNLKDADCAEVVQKLAQDYVVSKVEAASELAQVRSV------- 353
gi 302851714  300 RAIFRQYLEARGg------mLPADRHVLRELREKQTAIKLMDETAAEVVRDAARRTIESHLTRAIEVAKSTGKeltcagk 373
gi 552815218  299 KGIFKQYLDSHGg------qLQADKAFLVGLRQAQAAARLADDEAAALVKEAARARVEELLESAVKSTKQRTR------- 365
gi 460402942  296 QRLYASKLKSVG--------RDIDVNQLISLREAQLAYRLSDELAHEMLKEHARKLVEEIISTAVGILKSRTR------- 360
gi 359478503  295 QRLYAFKLKSVG--------RDVDVNQLVSLREAQLSCLLSDELAEDMFKEHTRKLVEENISTALSILKSRTRa------ 360
gi 586712470  296 QRLYALKLNSVG--------RDVDAMQLIDLREAQLQYRLSDEVAADMFREHARKLVEENITIALDVLKSRSR------- 360
gi 695070198  307 QKLYASKLKLIG--------RDIEVKQLIELRESQLLYRLSDQIAGEMFREHTRELVEENISSALSILKSRGKt------ 372
gi 721659745  314 KNLYTSQLKSIG--------RDLDIGTLIEVRRAQLAYKLSDEIAADMFREHAKKLIQENISSALDILKSRTKa------ 379
gi 566201416  293 QRLYTSKLKSVG--------KDIDVEQLVNLRQAQISYQLSDKLAEDLFRQHTRKLIEENISAALDRLKSRTRt------ 358
gi 356565914  279 QRLYASKLKSVG--------RDIDAEQLVTLREAQHLYCLSDQLAENLFKEHTRKLVEGSISVAHGILKSHTRs------ 344
gi 356553146  285 QRLFASKLKSVG--------RDIDAEQLVALRKEQQLCRLSDELAENLFRTHTRKLVEENISVAIGILKSRTKa------ 350
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75157412   368 AKSLASVVEELEKVLEFNNLLVSLKSHSEADQFARGVGPISLIGDESDF-ERRMDDLKLLYRAYVTDA-L-SGGRLEENK 444
gi 302766595  376 IKDTKKLVMELESMLAYNDLLSALAKDADSSSLVPGVGPASVIGGVYDS-DRAMDDLKLLYRTYLSEAvV-SNGQLLKEK 453
gi 255079196  354 NSDFTEANKLLTEVLDYNKKMGAGGD------ALPGLQVVTLAGSSFE---DKSGEANTLFRNFVTQG-T-EAGEFSAEL 422
gi 302851714  374 ARDITLLVEEVDAVLEYDRKLVKYGSEDD---LVAGLGMVTLHGGALDG-EGRTRDLKDVFRLYLEEK-LnRAGEFSAQM 448
gi 552815218  366 TRDYTEAMAALTAAVAFNRGLAALSSDPEV---IAGVGPTSVLGGAWEAaDGRSKDTRELFKIFLEER-LlSDGAFTDGL 441
gi 460402942  361 ATEPTRVIEELDKVLSYNNLLISLKNHADasrFAPGIGPVSLVGGEYDG-DRKMDDLKLLYRAYVTDS-L-SSGRMEEDK 437
gi 359478503  361 VRGATQVVEELNKALAFNNLLISLKNHPDagrFACGVGPISLMGGEYDG-DRKMDDLKLLYRAYVADS-L-SSGRMVENK 437
gi 586712470  361 TKGLTKVVEELEKIIAFNKLLVSLSNHPEvarFAQGIGPVSLLGGEYDS-DRKIDDLKLLYRAFVTES-Y-SSGRMEDKK 437
gi 695070198  373 SMGTLQVIEELEKVLAFNNLLTSLSKHSDsgqFAQGVGPVSLIGGEFDG-DRKIEDLKLLYRTYAEES-F-SSGCLQEEK 449
gi 721659745  380 ANSPTQVIEEVKIVLAFNSLLTVLSKHPQgdrFVRGLGPISLAG-ELDH-DRRAGDLKILYRAYATEV-L-SDGPLDNEK 455
gi 566201416  359 VQDVVKVVEELDKILAFNNKLISLKNHTDaasFACGVGPVSVLGGEYSS-ERKIDDLKLLYRAYITDA-L-YGGRMEEHK 435
gi 356565914  345 VYGVIEAVEELDSVLAFNNILISLKNHPDvdhFAQGVGPVSLLGGEYDG-DRKIEDLKLLYRAYIANA-L-SSGRMEDNK 421
gi 356553146  351 VPGVSQAVAELDRVLAFNNLLISFKTHPDvdrFARGVGPVSLVGGEYDG-DRKIEDLKLLYRAYVSDA-L-SGGRMEDDK 427
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75157412   445 LVAMSQLRNILGLGKREAEAISVDVTSKSYRKRLANAVSSGDLEAQDSKAKYLQKLCEELHFDAQKAGAIHEEIYRQKLQ 524
gi 302766595  454 LPLLAQLKNTFGIGNREADDIMLDITTKVYRRRLSLAVTDGDLDAATSKATFLQNLCNSLQFDPAKASKVHEEIYRQKLE 533
gi 255079196  423 KSSAGALKVLFGMGNKEAEEIVLDVTTKRYRELLRDAVKSGELDKAESPAKVLQSICEKLQFPPEVAADVNKENYRTKME 502
gi 302851714  449 DADAAELATIMCMGAKETQALRDEVSAKLYRRLLKEEVTSGRLDSATSPASVLQSLCDKVRFRPEAALELHRQLYKAKLS 528
gi 552815218  442 EADAAQLRTLMGLGNKECADIEADVKQAAYKRLLREEVTTGRLAAAESKAEVLGDLVERVRFDADAARAFHEALYRQKLA 521
gi 460402942  438 LAALNQLRNIFGLGKREADTITLDVTSKVYRKRLAQAVTSGELEAFESKAAYLQNLCEELIFDPQKALEIHQEIYRQKLQ 517
gi 359478503  438 LAALNQLKNIFGLGKRETEGIMLDVTSKAYRKRLAQSVSGGDLEAADSKAAFLQNICDELHFDPKKASEIHEEIYRQKLQ 517
gi 586712470  438 LEDLNQLKIIFGLGKREAETMLLEVASKVYRKRLAQAVSSGDLDIATSKAAYLQNLCEELHFDPQKASEIHEDIYKQKLQ 517
gi 695070198  450 LTALSQLRNIFGLGKREAENIMLDVTSRVYRRRLSRAFSGGDLDAAPSKAAFLQNLCEELHFDPNIASKIHEEIYRQKLR 529
gi 721659745  456 LIPLNELRNIFGLGKREAEAIISDVKSQVYRKRLAKCFNT-ELAAAPSKASFLQNLCEELEFDPELASKMHEDIYRQKLQ 534
gi 566201416  436 LAALNQLKNIFGLGKREGESIRLDVTSKAYRKRLAQAVSSGDLEYADSKAAFLQNLCEELHFDPLKATEIHEEIYREKLQ 515
gi 356565914  422 VAALNLLRKFFGLGKREAEAIMLDVTSRVYRKKLAQAVSGGSLEMTDSKETFLQKLCDELHFDPQKACEIHEEIYRQKLQ 501
gi 356553146  428 LAALNQLRNIFGLGKREAEAISLDVTSKVYRKRLAQAVADGELEMADSKAAFLQNLCDELHFDPQKASELHEEIYRQKLQ 507
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75157412   525 QCVTDGE----LSDDNVAALLRLRVMLCIPQQTVDTAHAEICGTIFEKVVRDAISSGVDGYDAETRKSVRKAAHGLRLSR 600
gi 302766595  534 QCVADGS----LSDEDISALLRLRVLLCIPQETVETAHADICGRIFAKVVNTAIASGVDGYDPETTATVRAAIKGLRLSQ 609
gi 255079196  503 QVMEKKK----LTDEDVEALGRVRRLLCVPKDVVDECTMDICGAVYKSAVLSALSVGTESFTPELRDRCKRAKDAVRLTD 578
gi 302851714  529 ALLEARRghggLTDGDVEDLKRIRRILCLPADVAKKVMRETAGREFEELVGEIYLAGAKPLGSYEAERVDRALKELRLDS 608
gi 552815218  522 SLLEKKK----LTEEDDVALREMQVQLCIQNEERDRMHAELCGALFKDAVTDALAAGIDGFGFQDRQRVQQAFKDLRLER 597
gi 460402942  518 LLVTDGE----LSDEDMKALERLQVMLCVPKQTVEAAHADICGSLFEKVVKEAIACGIDGYDTETKNAVRKAAYGLRLTR 593
gi 359478503  518 QCVADGE----LNEEDVAILLRLRVMLCVPQQTVEAAHADICGSLFEKVVKDAIASGIDGYDDDVKKSVRKAAHGLRLTR 593
gi 586712470  518 QAVADGD----LSDDDVASLLRLRVMLCIPQQTVDAAHADICGRLFEKAVRDAIAAGVEGYDADVRRTVRKASQGLRLTT 593
gi 695070198  530 QFVEDGE----LSEEEVASLQRYRVLLCIHHETIDAAHADICGRLFEKVVKDAIASGVEGYDAEVRNSVRKASKGLRLTT 605
gi 721659745  535 QFVADGE----LSKDETEALMAFQVRLCIPQETVDAAHTDICGQLFEKVVKEAIVS-VDGYNADRRDAVRKAAQGLNLKK 609
gi 566201416  516 QCAADGE----LSDEDVKALTRLRVMLCISQQIIDAAHSDICGSLFEKVVKDAIASGVDGYDADVKKAVRKAAHGLRLTR 591
gi 356565914  502 QLVADGE----LSDKDAAALLRLGVMLCIPQQTIDTAHSDICGSLFEKVVKDAIASGVDGNGAEMRKSVRKAAHGLRLTG 577
gi 356553146  508 KCVADGE----LNEEDVAALLRLRVMLCIPQQIVETAHSDICGSLFEKVVKEAIASGVDGYDAEIQKSVRKAAHGLRLTR 583
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|..
gi 75157412   601 ETAMSIASKAVRRVFTNYIRRAR--AAENRTDSAKELKKMIAFNTLVVTEMV 650
gi 302766595  610 KAAMDIASKAVRTMFMTYVKRSR--TADNRTESARELKKMILFNNLVVTELV 659
gi 255079196  579 DMALKILKNEVVKAFMAYIRVAR--TKQNKIEQSKEIRKMVYFNSTVVTPMV 628
gi 302851714  609 DVAVEVMAQITRERFRSYVTQAQreGSRDRRDFAASVKKLLQFNALMVTPLL 660
gi 552815218  598 PAA----------------RASR--NTRNRLDAAKELKKLVFFSNIVVAPLV 631
gi 460402942  594 DVAMTIASKAVRKIFITYIQRVR--GAGSRTESAKELKKMIAFNSFVASQLV 643
gi 359478503  594 EAAMSIASTAVRKIFMNYVKRSR--AAGNRIEAAKELKKMIAFNSLVVTELV 643
gi 586712470  594 DTAMAIASKAVRAMFTNYIKRSR--AAGNRTEAAKELKKMIAFNTLVVTQLV 643
gi 695070198  606 DAAMAIANKAVRRVFMTYIQRSK--GAGNRTEAARELKKMIAFNALVVTELI 655
gi 721659745  610 EAAMTIFSKAVRKLFLNYIQRAK--AAGNRIEQAKELKKLISFNTVVVSELL 659
gi 566201416  592 EAAMPIAGKAVRRIFLNYIKRAR--MAENRTEGAKELRKLIAFNSLVVTELV 641
gi 356565914  578 DTAMSIASKTVRKIFINYIKRAR--AAGNCTESAKELKKMIAFNTLVVTELV 627
gi 356553146  584 EVAISIASKAVRKIFINYIKRAR--AAGNRTESAKELKKMIAFNTLVVTNLV 633
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap