Conserved Protein Domain Family
KCH

?
pfam16944: KCH 
Fungal potassium channel
KHC is a family of fungal proteins carrying three transmembrane domains. It is a member of the fungal potassium channel family of transporters, and includes a pair of homologous sequences that localize to distinct zones of the yeast plasma membrane and are induced during the response to mating pheromones. Together KCH1 and KCH2 promote low-affinity K+ uptake and are essential for K+-dependent activation of HACS - a high-affinity Ca2+ influx system that activates calcineurin and is essential for cell survival - in S. cerevisiae cells responding to mating pheromones.
Statistics
?
PSSM-Id: 319020
View PSSM: pfam16944
Aligned: 94 rows
Threshold Bit Score: 174.235
Threshold Setting Gi: 919302764
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121737321   17 KWDYINLNDFKSESCWTPFSYFFIYVFLLISLAVYAVDTFTAVNLLAFSRWAG-Q-IKPTIPFTISRWIFAVCIIISFVL 94
40_pfamImport   1 TFDVVRVDDFYNHNCSTMCWYFYMWILVFLAIILLAIDIYSCLNILVFHKWAT-DdYRP-YAYSIAKWIFTGCIIFQFVL 78
4_pfamImport    1 TFDLIDVGKFHNLKCSTVFDYMFTWSLLILGVVLLGVDIYTCLNILVFHRWSS-DdYKP-YAYSIAKWIFTGCIIFQFVL 78
36_pfamImport   1 TFDLINVDRFKNTNWSTVFAYMWLWIMIFLSWILLGVDIYTCLNILVFHKWSS-DdYKP-YAYSVAKWLFTGCIIFQFIL 78
42_pfamImport   1 TFDLINIENFRNRDKSTVFAYIYTWVMIILSLVLLGTDIYTCLNILVFHRWST-KdFQP-YAYSVAKWIFTGCIIFQFVL 78
gi 74601263    28 TFDLINIDRFHNTKASTVFSYMFIWILMMLSWVLLAVDIYTCLNILVFHRWSN-DdYKP-YAYSVAKWIFTGCIIFQFLL 105
gi 459369219   32 TFDVIDVNNFRNYKFSTLFWYIYMWTLVFLSFALLATDIYSCLNILVFHKWATdN-YKPY-AYSIAKWIFTGCIIFQFVL 109
gi 126136981   18 TFDLIDVDKFYNTKFSTLMAYLYMWYLMVLSWVLLGADIYTCLCILVYHRWSSaE-YQPY-AYTYAKWIFTGCIIFEVCL 95
gi 260939844   14 TVDLIKIHELHNTRFWTVMCYLGTWFVILLKLAILGADTYTCISILVFHRWSS-D-DYQVYEFHVAKWLFTGCIVFRFLL 91
gi 927376993   16 feDLAEEHDYRVFNFWTLVSYLIMLTEICLSFGFLASDIYTLVQIYALNDWDS-YhAISYVPLLAYRIIFTTCIGISMTW 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121737321   95 LVLRWLHAIRAIRSGSIAQCYLDSLAVRVQSIRpgkrgrGWRRFIVFAELTKSKKGAEYVALFAYFSFE-SWMNTVFADG 173
40_pfamImport  79 LIYCWIWAIHIYRTKNIAMVYLNSICKKIYSIK------SYSCFCLMNSI-DEGKFFDQCCFNTYYEIQ-NAPQILIADT 150
4_pfamImport   79 LLYHWIWAIHTYRTRNIALAYVNNIARHLYTIK------SYDYHCLFNSV-EHDNFFDWACFLAYFEMD-SALQILVADT 150
36_pfamImport  79 LAYHLVWAIHTYRTKNIALAYVNSIARTMYSVK------SYNYHCLFHKI-DTDNFFDWACFLSYGEVD-NALQILLADT 150
42_pfamImport  79 LAYHWLRAIHTYRTKNIALTYVNTIARLLYIIK------SYNYHCLFHQI-EQDNFFDWTCFLCYTELD-GAVRLLIADT 150
gi 74601263   106 LIYHWIWAIHTFRTKNIALTYVNWIARLLYIIR------SYNYHCLFHQI-EQDNFFDWACFLSYGELD-NALQILVADT 177
gi 459369219  110 LFYHWLWAIHILRTKNIALVYLNSIAKKVYSIR------NYNYFCLLNNINE-GNFFDWCCFLTYYELD-NALQILIADT 181
gi 126136981   96 LCVRCVWGIRISSTRNIALVYLNPIARQMYSVK------SYNYFCLFNQI-KTNSFFRWACLYCNQELD-NSLQILVADT 167
gi 260939844   92 LAWQIAWAIHIYRTKNIALAYLNNYASLMYSVR------SYDYHCLFHAI-ERVGFFEWAAFFIYFNLD-DALEVLVADL 163
gi 927376993   95 LIANWWYGIHIYRTNSIVRSHLNDVARQINSLK------SYERFCIYERSTT-KSFFDWFSLTTYRSYYfSIYLWLLADT 167
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121737321  174 PRQVVNAITL-YSVMRMDLLpggehahkanddtpgVVQFFDNVKILAEENNLRALVLFGMLFTLVIWVLSVLKLLLAIIL 252
40_pfamImport 151 PRQVINILTLrYYATGGELN----------------NDILSNIRTIAKTNLRLSIILSFMCLSVFIYAIFFFKFLFGMLS 214
4_pfamImport  151 PRQVINILTLrYYATNENSS----------------NDIIQNIKQIATSNIRLSVILSFMLLSVAIWSIFFFRFVFGMLC 214
36_pfamImport 151 PRQVINILTLrYYATDGDLS----------------NDIIANIKKIADTNLRLSIILSFMCLSVIIWSIFFFKFCLGMVM 214
42_pfamImport 151 PRQVINILTLrYYATDRGKS----------------NDIIGNIRTIATTNLRLSIILSFMCLSVAIWSIFFFKFLFGIVF 214
gi 74601263   178 PRQVINILTLrYYATDGDIL----------------NDIIQNIKKIATSNLRLSIILSFMCLSFAIWSIFFIKFLLGMLL 241
gi 459369219  182 PRQVINVLTLrFYATGGELN----------------NNILQNIEAIAQTNLYLSVILSFMCLSVFIYAIFLFRFLFGMLC 245
gi 126136981  168 PRQVINILTLrFYATGGNYK---------------HSNILRNIKTIATTNLTLAVILSFMCLSLIIFVFFFFMYLYGMIL 232
gi 260939844  164 PRQVINILTLrYYATGGDLN----------------NDVLSNIKTIATTNIRLAVILSVQLLSVAIFAFFFFQFVLAMIF 227
gi 927376993  168 PRQILNGATVaYSISNSFTS----------------SEIVNVVVAIAQTNKREAVLLSFMTFSFIVWVIFTAKYICVIIG 231
                         250       260
                  ....*....|....*....|....*...
gi 121737321  253 YLIFLFHHIPS-EDGSLKAYCRRKINNR 279
40_pfamImport 215 YIPLKTSLRKE-GYKGFKSYCSYLVNKS 241
4_pfamImport  215 YIPCLMKIRKK-GHTRLKKYCCSVVNSH 241
36_pfamImport 215 YLPVIAKLRNK-GTKSLKKYCCKVVNDK 241
42_pfamImport 215 YIPVMVKLRDR-GYKSLKKYCCDVVNDN 241
gi 74601263   242 YIPVMVKLRKR-DYKSLKKYCCDVVNEN 268
gi 459369219  246 YIPLKVQLKKQ-DYHSFKDYCCYLINEH 272
gi 126136981  233 FLPVYFKMHSKsGYWSLRRYCCEIVNDS 260
gi 260939844  228 FIPIKVKLSDK-GFRSFKAFCYSRVNEK 254
gi 927376993  232 SFFVVSKVHSR-HGTTFRKYCRRLVADS 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap