Conserved Protein Domain Family
Porin_OmpG_1_2

?
pfam16946: Porin_OmpG_1_2 
OMPG-porin 1 family
Porin_OmpG_1_2 is a family of putative porins of the OmpG-type. these are channels without solute specificity.
Statistics
?
PSSM-Id: 319021
View PSSM: pfam16946
Aligned: 5 rows
Threshold Bit Score: 423.084
Threshold Setting Gi: 495349436
Created: 14-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 504495950 123 ADDVSFLRLRQEDPpvhwnsigsnmDAGGLHGNIGSQIEIDDVRW-----GNKNRNSGKFKLATIQAFLRHDELPNWYFG 197
gi 504495948  43 DEDVMWTSTRSSNP-----------AGGHIHGQLKMKYSIEDTNW-----RNSHFHNGSDSLTFVQGVMRNDNLPGWYLG 106
gi 495349436  45 SKAELLTALNAEPK-----------EDSKLHGTIGTNIEIE--EWsgsnsRGESWEGGKVKYSLANGNFRHEDLPGVDFG 111
gi 491611835  48 SNAELLTALSVPQQ-----------EESKFHGTLGSNVEVE--RLi----RDDGVNEGKVKYTIAQGSFRHDDLPGWDFG 110
gi 491576716  46 STAELLTALDVPKQ-----------EEAKFHGTLGTNVEVE--RVi----RDDGVNEGKVKYTLLQGNFRHDDLPGWDFG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 504495950 198 FWNAREDDYKGQFSNQDYS-GSNTINEFFVGHIFENWRGNIGTEVMIGSETATERWKTRFKVWQDLRLSDRWSVAGYAYG 276
gi 504495948 107 FSEGRTTNYNGPWEKQTYI-NQNQWTQLIIGHEYFYKRLRYGWDIMGGSSSIEDRWQARAKFFTDLRITNQLSFFNYVYQ 185
gi 495349436 112 FYMAREFNYNGSLFSADYD-GVNDITEIYLNKSYGIENGNIGWGVKYAQESADKRSTPEAKVFGSYQINDWLDIHGYGLY 190
gi 491611835 111 FYSGREELFTGNLKHADYNrGVNSIQEIYVNRSYNHEKGNIGWGLKLAGESIDQRTTPGGKVFGSYQLTDRLGMHGYALY 190
gi 491576716 109 FYSGREELFNGNLKHAKYDkGVNAIQEIFVNRSYGHDKGHIGWGVKLAGESIDKRTTPEAKVFGSYQLTNNLEMHGYALY 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 504495950 277 EYQPQGNQPGNGDLEQYIFETEPAIQYRVNPDLGLYFRPYYYYNRQV-RENWGDI-VEQEWKVTTGLWKNWYPLLTSMYI 354
gi 504495948 186 QIEHRRSGGSQNDRDIRSFQIEPGVQYIINNTNGIWLRQQFASAILD-RAQWGDI-DDKSWTTSFGIWHNWGDLSTTISS 263
gi 495349436 191 HVEIKQ---NLGNFDY--WEVEPGLGFKIADNMGAWLNFRYQQGTWD-EKGVSENnVETETIIKPGMWYSFGKLGTALFA 264
gi 491611835 191 HVEYKR---GTGEFPY--WEVEPGFSYKINDNTGAWLNFRYQEGQWKaKDGYSE--TETEWIIKPGIWHNFGKLSASLWG 263
gi 491576716 189 HVEYKR---GTGEFPY--WEVEPGFGYKISDNSGAWLNFRYQVGEWNaKDGYAE--TETEWIIKPGIWYSWGKLSASLWG 261
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 504495950 355 GFGQDKIVNA-SNSKELFYDGRYKFIGSTISYPVFGEVRLYGEFKASFTK-EAGQWTYNGHSWNPFTIVGVTYNF 427
gi 504495948 264 GYGHYKKNNArPEDGEVFQNTRNRFMKLTANYPLTSRFTVSGEITGSLIK-QSGSWVTNGDAITTDYKLMLDYNF 337
gi 495349436 265 EIGAFENEI--GATGKK-HKEDYVKVGASANYPLTKNWRIFGEVSYKTVD-IEYTDGATGDNTLPFGLIGVNYSF 335
gi 491611835 264 EFGSFEKSV--DSTGAHAWTEDYSKLGVSANYPLSKSWRMFGEASYKKIDfASGPQRDEFDGYIPLFILGVNYSF 336
gi 491576716 262 EFGSFEKER--NSDSAHLWTEDYSKIGISANYPLSKSWRMFGEASYKKLDlESGPERDAFDGYIPLFILGVNYSF 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap