Conserved Protein Domain Family
ABC_tran_2

?
pfam16949: ABC_tran_2 
Putative ATP-binding cassette
This is a family of putative two component ABC exporters. This is the membrane protein of approximately 573 residues and twelve transmembrane domains. It is encoded adjacent to an ATPase.
Statistics
?
PSSM-Id: 319024
View PSSM: pfam16949
Aligned: 5 rows
Threshold Bit Score: 600.965
Threshold Setting Gi: 494660051
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 503328415  76 SAIAESRLRLAIIVFCSIFFWATLFTFFRQAFTFLSKFDL-FAESLLDYAFSMYFLSIAGMLTFSTGIIGYNSLFLARES 154
gi 491151568  28 RPNRDKVTRWLLIGTLGTLFLIADYIFFYRMVAYLDGLPLrVGEELIVQLLNVVFLTLFAMLLFSTIIAALAIYYVSSDL 107
gi 494038607  40 SPAMIAILGGFIIGYLALGYW-----MFFEGLNFLYRFPL-VGSLLSQRLIYLVFGFFFIMLVFSNLIIGYSTLFKSRET 113
gi 494660051  37 SRLLTGLILCFILGYLGLSFW-----LFYKGLNFVASFPG-LGVVLTERLLYLLFAFLFVLLLLSNLIISYTNLFRNREA 110
gi 505062174  35 SLLSGSLLRCLMVLACSAVFWTVLFGIFFEGFMFVGMYVD-LKNTIIEHLFSMFFLSLLIMLFVSTGIIVYAGLFQSREA 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 503328415 155 EFLLTLPAPSDRVFAARFREAMLFSCWGFILIGTPLLVAYGLSEQAGALYYALILLFLIGFVLTPGAVGMLGAFLVGYFL 234
gi 491151568 108 EFLHSLPMVPDAIIHVRFVQTLINASWVVLVFSLPMFIAYGFYFKVTASYYIYLLASFLPFVVLPCALGVLGIMVLMRFF 187
gi 494038607 114 TWLLSLPLPPPNIYRWKFLEALAVSSWALLFLSAPLMFAYGRVHEASPIFFLEMAVVFVPFVIIPALVGSWAVIFLVRLL 193
gi 494660051 111 SFLMTLPVPAQTIFRWKFLESSLLASWAFVFLIAPLLAAFGLTRHVPWHFYPVTLVLIALFIVLPSVAGSFLAVNLARFL 190
gi 505062174 114 AFLLTTPASTDRIFVYKFFEAIVFSSWGFLLLVSPMMVAFGITVIAKWSFYAIFLVYLLSFVMIPGSLGAVAAILVANFF 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 503328415 235 PRRYKTVLVLAILAVIAFVGFVGAQLLqSEEGGFNADW----LDNAMGRLAFSQSEWIPSVWITRGLMAAADGEVGEALT 310
gi 491151568 188 PTDKAHQILSFLGLFFVAGLVAFLRFL-SPEKFFDKKVsdevIIDFVESLRVPEFPYLPSSWITRGLTAWTEANFEISFG 266
gi 494038607 194 GHRDVKNIVLVISLGVLALLIAGIKPVtDAEALSQEDVl--sFDQLLRHTRISVNPFLPSAWLAQTVLAWSEGLTRQGLF 271
gi 494660051 191 DRRTFQVALVIFALLLLGLAGYWWKTQpTPDEMLETRVla-vLDQLLQKTRFSLFPFLPSYWLTSSVLQWAEGVLSLAGF 269
gi 505062174 194 PRRQKTVLILGGGLILIGAAFVVTQITtTPGSALSTDW----LGGLLGRLAFSQHPLLPSRWMSAGLLASARGNWSDGLF 269
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 503328415 311 YLWVTWANGGMAYLCAALAARLFYRPAFSRVQGGRSSRRFAGQ-WSSAf--------------DRGFHRCaGFVDrPIRL 375
gi 491151568 267 RLGFLYAAAGVGLILFAWISRQIYFPGWRSYQEVKNTPRTKNKnNGRR---------------KPLLSYL-PIEP-MKQA 329
gi 494038607 272 SFLLLLSYAMMGLLVGYEVIGRFFFGSWTMALSSRAA-RFQRQaVARRqrerr------pellEYITNFLrPWSP-PTAA 343
gi 494660051 270 FMLVLLSNVMFFGFLGFTRLGKMYYNA-ASEVQSRAS-VWSQWeWFKAaserkkdlaythgpiEKIFNQLhWLQS-DTRA 346
gi 505062174 270 YLMVLTAHAGLFYLVATVVARDLYRQGYSRVQGGRSSRRRSGLyWi-----------------DALFHRLfFFIPhPVRL 332
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 503328415 376 LMLKDFRILRRDPTQWSQLLILVGLLGFYFLTVRRLGSDqsPPSWRSMLSFLNLAVTALLLSTFTSRFVYPLMSLEGRNF 455
gi 491151568 330 LISKDLKVFARDPAHWSQIFILLVLVFVYIFNIMNLPLD--NLVLKNVVSVLNIGLIGFVLSALIARFVFSSISIEGKKM 407
gi 494038607 344 LVLKDARLFWRDPAQWIQFMIFFGLLCIYVVNLRNVAFNfqNPFWETMISYLNLAACSLTLSTLTTRFVFPQFSLEGRLL 423
gi 494660051 347 LLAKDARMFWRDTSQWGQSVLLFGLLGVYIINLRHFTSQlaSPFWIHLVSYLNLGACSLNLATLTTRFVYPQFSLEGRRL 426
gi 505062174 333 LILKDLRTFRRDPAQWSQFLIFFGLLAFYFLNIRRLSYDvqSPYWRNLVSFLNLAVTALILSTFTSRFIFPLLSLEGRNF 412
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 503328415 456 WVLGLFPVQRDSILWGKFAFASGLSIVATGAMVIASDILLRVGPLMIVMHVGLMSLICLGLAGISVGLGARFPNLRESDP 535
gi 491151568 408 WTLYTAPVDMRSFLVAKFWMYWPPLLLVAEILTVASNYILQVDAYVMKVSVVGVLLITTGLVGMGVGMGAMYPRFDHENM 487
gi 494038607 424 WLVGLAPIGLRKVLLQKFWTSVFTTTAITVSLMITSSLMLHLPWLRVGFFAVAIALMSATLSGLSVGLGALFPNFKEDNP 503
gi 494660051 427 WIIGMAPMGLERVVKTKYWLASCSSIVVTLTLIVVSSYLLDMTWERILFFAMVIAVMTFTLNGLAAGLGVLYPNFKEGNP 506
gi 505062174 413 WVLGLLPLKREAILWGKFAFASGISLVATEVLVVLSDLMLRMSTAMIALHMGMVAILCLGLSGISVGLGARLPNLKETDP 492
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 503328415 536 SKIAAGFGGTLNLLLSLVFILLIVLTVGLPTHL----AVstteTVLSTTMLLQDARLSWTLGLALTACLIVGllavILPM 611
gi 491151568 488 SEISTGTGGILFMISSLAYVMLVLVLSARPMYV----HF----NEKFLFKFVGGIEVPVFYGTIVALTVLVT----WIPM 555
gi 494038607 504 SKIVSGFGGTLCLVASFLYITLFVSLSALP-------------DIARVSKFPWEVPTALPYALALLLSFSVM----LFPL 566
gi 494660051 507 SKIVSGFGGTFCLVLSFFYILGSVLMLAFG-------------SNEMRDQVTSQDMAFLSIAGFILLSFLLG----WLPL 569
gi 505062174 493 SKIAAGFGGTLNLLVSLVFISAIVTALALPCHLyfagQD----ASEFRTFVLSEERFRFWMAIAVVTSLVIGavgtFLPL 568
                        570
                 ....*....|..
gi 503328415 612 RAGLKAFRDAEL 623
gi 491151568 556 KRGIRALRTMDI 567
gi 494038607 567 LLAIRRVKNLEI 578
gi 494660051 570 RLALRQLKKFEF 581
gi 505062174 569 RIGIKAFKRMEF 580
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap