Conserved Protein Domain Family
Collectrin

?
pfam16959: Collectrin 
Renal amino acid transporter
Collectrin is a single-pass transmembrane protein that is homologous to the C-terminal region of human angiotensin-converting enzyme 2, ACE2, found in Peptidase_M2 pfam01401. Collectrin is critical for normal amino acid reabsorption in the kidney.
Statistics
?
PSSM-Id: 319032
View PSSM: pfam16959
Aligned: 37 rows
Threshold Bit Score: 199.376
Threshold Setting Gi: 426395271
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71152217  617 SIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIP 696
gi 573902920  27 AYKVRLSIKTALGKNAYEWNESELFLFRATLAFAMRRYLNKE-----NFNVSSVIVCKETPRVSFWFVITDPGNTSKLIP 101
gi 597744102  28 GYKVRLSIKTALGDDAYEWSKSELFLFRAVLAFAVQR-----KTNNVNYDVSNILVCDETERVSFWFVVTTPDNTSELLP 102
gi 637282145 626 eIKVRISLKAAMGNSAYTWNDNEMYLFKSTIAYAMRQYFLIIKKETIEFRSTDIRVKNVTPRISFSFTVSMPNDSASLVP 705
gi 149638366 621 AIKVRISLKSAFGEDAYEWNENEKYLFQASVAYALRQYYLQDQNEIVNFQTDDVIIYNETARISFYFKVQNRRD-SIYVP 699
gi 348504892  27 GYKVRFSIKTALGDQAYPWSKNEMFLFRAALAFAMRDYTNGEE-----FGVSDIHPCDETKRVSFWFVVTRP-NTTDLVD 100
gi 551525490  27 GFKVRLSIKTALGDKAYEWNRNQRFLFQAAIAFAMSHHLDLE------FNVSNVLVCDETPRVSFWFVVTSPGDPSRLVG 100
gi 94574037   41 GFKVRISLKTALGNDAYEWNESEKFLFRSTLAYAMRKKTGEDT-----YNIENILVCNDTKRVSFIFVVTLPADPTQLIP 115
gi 449483118 617 AIKVRISLKSALGDQAYEWDESELFLFKSSVAYAMRKYFAEVKKQKAAFDITDIHVGEETQRISFYITVSMPGNISDMVP 696
gi 874458479 617 AIKVRISLKAA-G-QTYEWNKSELFLFKSTIAYAMRTYFAQ-KQQLIDFEATDVHVSEETQRVSFYITVSMPGNASNIVP 693
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 71152217  697 RSEVEDAIRMSRGRINDVFGLNDNSLEFLGIHPTLEPPYQPPVTIWLIIFGVVMALVVVGIIILIVTGIKGRKK 770
gi 573902920 102 RTDVEHAVRMSRNRINSAFLLTDKTLQFIGIPPTMAVPLEPATQPWLIVFGVIISLVMVAILALIIHGAIQKRR 175
gi 597744102 103 KLVVENAIRENRHRINSAFLLTDQTLDFVGINPTLAAPIEYDTPPWLIVFGVVMGVVCAGIVALLVSTFLQKKR 176
gi 637282145 706 RAEVEKAISMSRGRINEAFKLDDETLEFVGIYPTLAPPYEPPVTVWVIVFGIVVGIVVIASIALIIMGVRDRKR 779
gi 149638366 700 KDEVENAIRMSRGRINSAFQLDDNTLEFLGIPPTLAPPPVPPVTIWLILFGVVMGVVVIGIAALIVTGIRDRRR 773
gi 348504892 101 KGTVEMAIKKSRNRINGAFLLTDQTLEFDGIYPTLAAPVSPDTPPWLIVFGVVMGAVSVGIIALLAYPLVQRKl 174
gi 551525490 101 KESVELAVRESRDRINNVLLLNDATLEFVGVLPTLVAPVKPATPPWLIVFGVVIGIVGAGIVFLLVSTVVQKKR 174
gi 94574037  116 KEEVERAVRQSKHRINNAFLLSDMTLEFVGVPPTLAVPIQYNTPPWLIVFGVVIGIVAVGIVALLMSTVSKRRR 189
gi 449483118 697 KADVENAIRMSRGRMNEAFRLDDSTLEFVGILPTLAAPYEPPVTIWLIVFGVVISLVVIGIIALIVTGLRDRKK 770
gi 874458479 694 KADVESAISMSRGRINEAFGLDDDTLEFVGIIPTLAAPYEPPVTIWLIIFGVVISLVVIGVIVLIVSGQRDRKK 767
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap