Conserved Protein Domain Family
HpuA

?
pfam16960: HpuA 
Haemoglobin-haptoglobin utilisation, porphyrin transporter
HpuA is a family of Neisseria spp proteins from the hpuAB operon, which are putative porphyrin transporters.
Statistics
?
PSSM-Id: 319033
View PSSM: pfam16960
Aligned: 2 rows
Threshold Bit Score: 511.124
Threshold Setting Gi: 489780998
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489847229  30 VSIPTATPLtaGEVTLSSDNGNIENINTAGTgstSGISIQQREVEKEPFPDyKIKETSFIFKTPGGAQYALSTYADPIIp 109
gi 489780998  31 VAIPTAQPI--ANVKLSDESSAIQTINTLSG---KGGSLHEAELEVKTSWG-SYTDKQYVYQTPSGNYYNISSYSDPIV- 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489847229 110 PSNETPDFKMPDRHAGQRLADGSRIFICCSESGANDFAEITKQDYMKFGAWIGPNGKIDLFAGGFPVGKTPESVGSTTPE 189
gi 489780998 104 PSYSSPSYALRTRHEGQPLSEGGKLFVCCSSSGQFTNAPATKHDHLKFGAWISSDGTADLFVGGKPVGTAKPSYYTPSDS 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489847229 190 T--KGKITYQVWGIRVRNGQFVTSSYTPPK--GsiyYGYENTPVLSFITANFNSNRLAGEIRGNSDYGPDVEIKDAMIDG 265
gi 489780998 184 TvaKGKTTYEVWAVRVRNGNIVTSTYDPGKssG---LSEKNTPKLSLLTANFNTNKLGGTILGNADYGPDVVMKDVGING 260
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 489847229 266 LNFSGTATSGGKTGNLEGKFFGKFNG-YrDSETSIGGKITFQDDRSLDTVFGGVSYEKKPNeTTDMSTDHLKK 337
gi 489780998 261 VDFSGTAESDGKNGKVEGKFFGQFNSgY-KTEVSIGGKVTFDADKSLDTVFGGVENSSDRN-TTDTSLTPVSK 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap