Conserved Protein Domain Family
TipE

?
pfam16972: TipE 
Na+ channel auxiliary subunit TipE
TipE appears to be a family of insect Na+ channel auxiliary subunit proteins.
Statistics
?
PSSM-Id: 319041
View PSSM: pfam16972
Aligned: 3 rows
Threshold Bit Score: 787.302
Threshold Setting Gi: 568252549
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121992456   1 MGDEADKRTGKEKLLFYTTAFFILLGTFSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDTEIFYGAKNCSWSSCRE 80
gi 568252549   1 MDEEIVPRTFREKALFYTTAFFILLGTFSLFAFLFLVPFVIEPAFQTIFMQFDESPALCVTAYNEHLHGAKNCSWTSCRE 80
gi 170036172   1 MDEEIIPPTTREKLLFYTTAFFVLLGTFSLFAFLFLVPFVIEPAFTTIFMQFDEEPAFCVTVDIEHFYGAKNCSWASCRE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121992456  81 GCTKDIYTCTQIRVNYR----LNLYNFTDEfnfteyhiNLKE-SERVIPPVKRTDRYERALRDYE------YDNLGGGID 149
gi 568252549  81 GCTKDIYECHQIRVNYKtaaqLAAAAAREE--------AAAAaAVRRLPAVTCSRQPDHYVRCGDvggasaSSSKNSGRD 152
gi 170036172  81 GCTKDIYECQQIRVSYKtsaqLAEAAAAESggfddssmTTSTvASKAATATATKTTGDSSVSN-DssksslTNNLNSDSD 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121992456 150 GTGLDIDIGAGG---------RLDQLSFGDADGSNGfLIEDSDDERGL---------SATGTLINDERHPFDEISELNEG 211
gi 568252549 153 PAGVAGGGGGGGntryanplyRFKRAVRADYDYSDL-LLEENLNGGGMggggfgdgrTGFKSSLIDDENAFIEYPEEMTG 231
gi 170036172 160 NSKTN------------------KPISTADQESSAG-LYDSSKNTGSCh-------rTAYSSLW--RRYTLIEYPDDMTE 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121992456 212 LMGNRSMYYYVGARLFPNVKGCGYPPMLNCTIWLRRYTKIGMKFPCYYSRVDPSLVISDLDYWQNTLNLVYSMAIPIPSF 291
gi 568252549 232 LMGNNSEWYFTGARLYPNVKGCGYPPMLNCTIWTKRYWTIGTNFTCYYSRVDPELVISDLDMWQNTLNLVFAMAIPIPSF 311
gi 170036172 212 LNGNESEWFFTGARLFPNVKGCGYPPMLNCTIWTKKYWKIGNNFTCYYSRVDPGLVISDLDMWQNTLNIVFAMAIPIPSF 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121992456 292 IISVIYLTYAYFKIYNEDEETAPLDKNAEDMDIDD------------IDAVDDSDGAVLADNV-------------AGSQ 346
gi 568252549 312 IISVIYLAFAYFVIFNEDEEAALLDKNGEEEATEDeladtdegndnkINNENEGEVVVTANHInekqqqqqnhnhtTGST 391
gi 170036172 292 IISVIYLAFAYFVIYNEDEEAALLDKNGEEEGTEDelaetdegndnkI---NESEAEITANHInenn------vdgGGNT 362
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121992456 347 IINMDSTTNDSCLEGVLPNGGPGMTTSisqgGSVTTPgpyiAQSPAGSQ--MTPNS--EMNSFGHQLKVQMADELSRDSL 422
gi 568252549 392 DDGDVNTTATTPIQPLQPNGTVNNSMN----NTNTTA----TTNTNGSSkpITPNSttDLNSFGHQLKVKMADEMSRESI 463
gi 170036172 363 ----APTTTTTPVQQQLPNGTANSITNmnntNTNTTA----TTNTNGSSkpITPNStsDLNSFGHQLKVKMADEMSRESI 434
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|...
gi 121992456 423 E----------NGVLSTSNSVQGNLSKTMTTSISTPPGPTAAV 455
gi 568252549 464 DggggvggvggGGLLSNSVSLQGNLSKTMTTSISTPPGPIAAV 506
gi 170036172 435 D----------GGLLSNSASIQGNLSKTMTTSISTPPGPIAAV 467
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap