Conserved Protein Domain Family
Flp1_like

?
pfam16982: Flp1_like 
Putative Flagellin, Flp1-like, domain
Statistics
?
PSSM-Id: 319050
View PSSM: pfam16982
Aligned: 71 rows
Threshold Bit Score: 25.5058
Threshold Setting Gi: 524470546
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*....
gi 524241116 22 DFKTEEKGaAEIVAILLVIAAVVVVAVIFRKQLGKLINGVFDKVGKEAG 70
gi 502251026 18 KFMCDEEGdVNIVSIVVLIGIAVLLALFFKDQIHDLLDSLFKTISGNAT 66
gi 503682593 11 RFWKEEDG-LGTLEILMIIAVLLIIAIAFRKWIMKWMQSLFGAADTQIN 58
gi 506323091 11 SFWRSESG-LGTLEVILIIAVVIIIALLFKDWIIQLIEKLMGKADDEAD 58
gi 644570973 10 SFWRDEEG-LGTLEMILIIAVLVAVVVLFRQKIKEVISDLIDTAGEKSQ 57
gi 503135302 12 kLHKDEDG-LGTLEMILIIAILIAVAIIFKDQIKKIVEGLLKKADKKSN 59
gi 506217452 12 aFWKDEKG-IGTLEMILILVVILIIALIFKDQITALVNNLFKNVNNKSK 59
gi 504019791 17 KWLSDEKGeVNIIATVVLMGIAVILAIIFKDKVKELLDVLFAKLTENAT 65
gi 524467576 18 SFLHQERGaVDIVAIVILIAIAVVLAVFFKEQIASLLKTMMKTIQEKAG 66
gi 524129634 18 NFLTNEDGaVDIVAIVVLCGIVIAVAVIFRDELQKVVESLFQTVKDKGN 66
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap