Conserved Protein Domain Family
Glyco_trans_4_5

?
pfam16994: Glyco_trans_4_5 
Glycosyl-transferase family 4
Statistics
?
PSSM-Id: 319058
View PSSM: pfam16994
Aligned: 17 rows
Threshold Bit Score: 136.82
Threshold Setting Gi: 496460160
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75146224   66 SKLVLLV--SHELSLSGGPLLLMELAFLLRGVGADVVWITNQKPLEddev-vysLEHKMLDRGVQVISA---------KG 133
gi 168008346  57 GKSVVVV--SHELSLSGGPLLLMELGHILRRSGAFVYWVTGNKKENtsdpvvvfLEEKLLNHGLQVIPA---------RG 125
gi 302786982  64 GKNVVLV--SHELTLTGGPLLLMELAVLLKNAGATVQWMTINKRDGagsevtdnLEQRLQNKGILLVPA---------KG 132
gi 295102222 179 GKRVFIM--SHLLDMTGAPIVLVSAVPVLRSMGYEVVVLGPED-GG--------SMPLFLEAGATVITR---------KG 238
gi 492689004 179 GRRALIL--SHELTMTGAPIVLVSAVPVLRSLGFEVVVLGPSD-EG--------SLPLFLDAGAAVVTRpd-----cvTS 242
gi 496460160  33 GKKIIILisNNSDGSGGAPVVLYEYAKYLNSSNNTTLFLAG-KGGE--------IISDARERGIPAFRMgfmykwyirKI 103
gi 947099027 240 SRRFVLI--FHELSMTGAPLSMMELATELLSCGASVSAVVLSRKGG--------LMQELARRRIKVLDD---------KA 300
gi 297735089   3 SKRVLLV--SHELSLSGGPLLLMELAFLLRSVGAEVCWITNHKPSEtdev-iysLENKMQHRGVQVLPA---------KG 70
gi 475621129   3 SKLVLLV--SHELSLSGGPLLLMELAFLLRQVGCQVVWITNQRPEGtndv-sysLEHKMLNHGVQVLPA---------RG 70
gi 769816217  72 SKLILLV--SHELSLSGGPLLLMELAFLLRNGGAQVVWITNQNPAEpnev-vysLEHRMLDRGVQVIPA---------KG 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75146224  134 ----QKAVDTSLKADLIVLNTAVAGKWLDAVLKENVVKv-LPKILWWIHEMRGHYF-----NADLVKHLPFvagamiDSH 203
gi 168008346 126 ----TRTVSALTTADLVILNTAVAGKWVSSAFKADIKKl-LAKTLWWIHEMRGHYF-----APEYVKFLPEvagvitDSH 195
gi 302786982 133 ----EETVRAAVDSDLVVLNTAVAGKWIDSTLKESDQQrvLPKVLWWIHEMRGHYF-----TLNYVKHMPEvaavmiDSH 203
gi 295102222 239 cvqsPLLWGLALCADLVLANTVVEARAVRALS-----Ga-RVPVLWWLHDAFAGYP-----HIAH--------------- 292
gi 492689004 243 ----SALWGLATSADFVLANTVVEAPVVNTLN-----Gs-FVPVLWWLHDAFAGYP-----FISH--------------- 292
gi 496460160 104 ----QQL-----DLDAIVVNTITMYKYIDQLIENNKl---NHKIIWWIHEEDRILK-----SFAH--------------- 151
gi 947099027 301 ----YLSFKIANKADLVIAGSAVCTSWIEQYIEHFPAG--ANQVAWWIMENRREYFdrakdVLQRVNTLVF------LSE 368
gi 297735089  71 ----REAINRALKADLLVLNTVMAGKWLDDVLKENVPHv-LPKVLWWIHEIQGHYF-----QLEYVRHLPLvaaamiDSH 140
gi 475621129  71 ----QEAIETALKADLVILNTAVAGKWLDAVLKDNVPQv-LPKILWWIHEMRGHYF-----KLEYVKHLPLvagamiDSH 140
gi 769816217 140 ----PEALETALNANLVILNTAVAGKWLDAVFKEGVSRv-LPKVLWWIHEMRGHYF-----KLEYVKHLPFvagamiDSH 209
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 75146224  204 ATAGYWKNRTQARLGIKMPKTYVVHLGNSKELMEVAEDSVA 244
gi 168008346 196 ATADYWRTRTRDRLRMTLPKMHVVHLGNSQQLMLDAEDAVG 236
gi 302786982 204 ATAEYWKNRTQQRLGIKIPKVHVVHLGNSKDLTEAAENPLA 244
gi 295102222 293 --------------------QIPRELGENIRLYSVGSHAAN 313
gi 492689004 293 --------------------SIPKALGKNVHLCAVGSHATA 313
gi 496460160 152 --------------------YMPKQTNQNLRIMCVSERIKD 172
gi 947099027 369 SQSRQWQKWCVEEGIKLSSQLALVPLSVNDELAFVAGIPST 409
gi 297735089 141 VAAEYWKTGTRDYLRIKMPDTYVVHLGNSKDLMDIAEDSVA 181
gi 475621129 141 ITVEYWKTRTHDRLNIQMPQTYAVHLGNSKELTEVAEDNVA 181
gi 769816217 210 TTAEYWRNRTEQRLGIKMPQNYVVHLGNSKDLMEAAEDSVA 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap