Conserved Protein Domain Family
DUF5089

?
pfam17002: DUF5089 
Domain of unknown function (DUF5089)
This is a family of microsporidial-specific proteins of unknown function. There is distant homology to synaptosomal-associated 25 family proteins.
Statistics
?
PSSM-Id: 319065
View PSSM: pfam17002
Aligned: 13 rows
Threshold Bit Score: 136.734
Threshold Setting Gi: 667641244
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622079    22 QDVVEEAERIEEQN-YERAKGVRMQLDESALKQKATTEELMRQGETLENAKKAAIGINTNARRGSELTEDIDREGRVFSC 100
gi 484857864   52 EDILQEAQQVEEEN-YQTAKDIRMQIGSAAIEQKGATEEMRRQGETLDAAKRAAVGVHREARRGDVLADDIEREGHFFNF 130
gi 300706604   34 NSILKEAKRIEEEN-YEQAKDIRMQLGQAAIEQKQASDEFRRQGEVLDNAKKSAINVHKEAKKGEELAEDIEREGSIFSC 112
gi 269859949   26 NVILEEAAKIEQMN-YQKAKQARQNLEKAIDTQKETTQTIRAQGEKIFKAKQSAVRAHQNAIAANDLAVELHENRSAWAF 104
gi 667642532   21 GAFIEEAQEIESQN-CLKAKSILAKMERTIDVQNETIQEIKLQGEKLVKIKESSIAVYKNAEAANEVSHRIRQESSIFPS 99
gi 402468638   28 EEILEKAAQIEHET-FLTAKQARQKLQQSAKQQQKTTISLEAQDEKLENIRMSAYQAKANAKDGEQLAKDIKQAGKVFGF 106
gi 906372004   33 dsstssNDRVENSDlFDIIKKANKGLAGSIRTSKDTTKTLNKQGKSLNKSLQKKKSIRKRVGKDEDLVRNINAEGNIVVI 112
gi 440493841   28 EEVEARAKQIEEQN-YEMAHGARKKLEAGYATQKKTTKELQSQGEKLERAEMSARSIEQDVEEGKHLTRKIKEEGKMFNF 106
gi 906372694    9 ktkdnylEELESVN-YKTSLEAKKTLNSILRTTDKTTAMLYEQREVLEDIRNDSYTAKDNLEKSKGLTVKMKRAGKLIVI 87
gi 523780680   24 DEILQEASKLESQN-YSMAHSARKNLQSAQQTQKETGKELISQGEQLKNIEGDAKDTHENVKKSEQLTKDIKKEGKLIHF 102
gi 667641244   36 EEAAKKATKIEKGS-YNRARKARKKLEEAEQKQKMTTEEVRKQNESLEHGRQGAFKVHEEAEKAKDTAITLEKERNAFDI 114
gi 1027189903  12 DNYLEE---LESVN-YKTSLEAKKTLNSILRTTDKTTAMLYEQREVLEDIRNDSYTAKDNLEKSKGLTVKMKRAGKLIVI 87
gi 1027190005  33 DSSTSSNDRVENSDlFDIIKKANKGLAGSIRTSKDTTKTLDKQGKSLNKSLHKKKSIRKRVGKDEDLVRNINAEGNIVVI 112
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622079   101 ELPCVRTIKRWFRGN---RGNIDDIVDRNQD-----S-----GSESERmpERVEFEEDGEEYIKGQNKTDREMVGVLNAV 167
gi 484857864  131 RCACLEKLFGWFRKDp-nDEKVEEIANKEVK-----S-----MGDSSY--EREDFVPAEKEMVPGQNKTDKELNEILNTV 197
gi 300706604  113 RFACFDRFCRWLKGDs-gSQEVEEIESKKYD-----Y-------EEAPpvQEEEFHP-GEEFVPGQNNTDKELVGILNTV 178
gi 269859949  105 NCGCLTGIKQWCAREr-nPTDVDALLNKNQE-----E-----ISSTEe-vSVEEYNPNGEEYVKGEHQTNAELSKILHGL 172
gi 667642532  100 FSNLFRGVKRWWKKDrrgEKYIESIKNRKKE------------DVTAPavTEEVFEPLNEETVPGENKTDSELSKILTCV 167
gi 402468638  107 NIPVVSSIKRYFSKGakmDRELLEQQRRNKN-----I-----GEFSADqdEHTDKINRQVEDNDDIDPTDKELMLILDEL 176
gi 906372004  113 KSSFLDRLRNFFSPQkwhEASVDQSAKREEEraeecS-----KDEESDglSSEDEIADNLENTGSDEDVDAELEKTLTGL 187
gi 440493841  107 KLPFVGRIKKIFKSKkqpGHAVHTHKKERQA-----A----------PkpQDESEIVTDKNLIPGQQKTDKELEQIYRTL 171
gi 906372694   88 GDKVSDKLKSIFKSApkpKQNFPSFTSPTDH-----Aa-----------pDSEEFPTEEKEIT--KETTNDVLISIRNGL 149
gi 523780680  103 GNPF-SFVKKMFKKDdknERELKTTLNKKDE-----SkhntyKSDKNNskNDKNLITTDKEDVPGEAKTNKELNMIYSTL 176
gi 667641244  115 LAPAKAKYGKWAAKDaqaAAEIEQMKNKSSE-----Q-----LENEAMseNKELGNLNAK--TEAEAKTNKELQKIYKSV 182
gi 1027189903  88 GDKVSDKLKSIFKSApkpKQNFPSFTSPTDH-----Av-----------tDSEEVPTEEKEI--TKETTNDVLISIRNGL 149
gi 1027190005 113 KSSFLDRLRNFFSPQkwhEASVDQSAKREEE-----RaeecsKDEESDelSSEDEIADDLENTGSDEDVDAELEKTLTGL 187
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 74622079   168 RQIRAEADKQNKESARHKSIVNDISMINERSEKVIKDTDKELKK 211
gi 484857864  198 KGIRSEAELQGEEAQRQKTVVKDISAVNEQAEKVIKRTDTKLKK 241
gi 300706604  179 KGIKQEAELQSREAAKQKSTIKDINRVTEQSEKVIKKTDEHLKE 222
gi 269859949  173 KRINKEADVQTKLATQQKSDLESIAQANEYTQRQVEKTNQRLNK 216
gi 667642532  168 KKVEAGARTQLQILKTQDDDINDITKIGEYSKGIVDSTEKEMRK 211
gi 402468638  177 KGMKGESKKQNYLIKSHKTKIEEIAKVNKNTEHYISKTNKKLKD 220
gi 906372004  188 QSLRRSVHFQTQKIKSQRHAAKEMQLLDEDTSKRAKKLEEETKH 231
gi 440493841  172 KNVKGEAQQQHEEMARQTQNIKSIGKRTQKSEKEMENVTEELKK 215
gi 906372694  150 KTLHSKLDKQNKELNSQNPLIQDITETNKKSSTEAEKVMKSLKK 193
gi 523780680  177 KDMKKDASTQQQEIKKQKLTTERIGAYSKASEAKMKKTEEELKK 220
gi 667641244  183 KRINKETEVQSRESKKQKSKLGDIMKTSEYAKKSVKETDEKLRK 226
gi 1027189903 150 KTLHSKLDKQNKELNSQNPLIQDITETNKKSSTEAEKVMKSLKK 193
gi 1027190005 188 QSLRRSVHFQTQKIKSQRHAAKEMQLLDEDTSKRAKKLEEETKk 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap