Conserved Protein Domain Family
DUF5087

?
pfam17006: DUF5087 
Domain of unknown function (DUF5087)
This is a family of microsporidial sequences of unknown function.
Statistics
?
PSSM-Id: 319069
View PSSM: pfam17006
Aligned: 8 rows
Threshold Bit Score: 250.801
Threshold Setting Gi: 906375061
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621430  102 FKDAFTIDSLLSYSGEAHN-FSLNSRADVKMKKSFHTNVKQQIDKIIRHMMTNLNTYDLNTICSTFNLISGDVEYQHKLV 180
gi 667640360 127 FKLNFTFKKFVDYAETTYE-FSLFNKKVMKAKNPLKQFIEANLDRIVKYILDNVNTLNLNQICSTIFLINSEMAYKHKLV 205
gi 667631999 116 FKLNFKLDEYVDYTCSLFVpYICDAKDTYKLSKQHAIYIKTNRKCILKHIFKDINTREIEKTWTLLFNLGCTESYEALCV 195
gi 402468677 185 FKVNIAPKEFVDYVENAIF-----AKQDAKLRI---LYVKNNTECIVKYLLERINRLSPYATYTTLNMVCNYLTSDQVKV 256
gi 523779729 161 FKSNYSFEEFIDFIDSQIVpYIFDEKKKIRLNKTLKNYIEINIKGIINLIIKTLNDNDVEKVYTILLTISIYSSYEIIIL 240
gi 817545645 124 FKDNVYFDEFMDFCSDTYViNSFEVTKVSHGKN-VKKYLQENKTHILKYLILNINKIHFTSVCSTLLALSTEFTDLEKCV 202
gi 269861131 166 FKTNYTLQQFIDYIGNSFE-FQLDIRKPHKIKNPIRGYVISNLDKIILYLMQNINILSLKNICTTLFYINNEIEQKHKLV 244
gi 906375061  50 nKTKEKRKRKLDECNNEVKlLDIEEKA------------KTNMVEALKEIFDTFNIMEQPEIRRIFLKILPYLDNSLKYL 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621430  181 IAHDIILFIDDFSRTPFIISALFNN-Q-GIRND--VLGGTIKEILLHQC---TIDKDIYKNNpH-LVGYYNKIIDNFELH 252
gi 667640360 206 IFHDIVLELSSHSKLNLIAAALFNN-L-DLEND--VFSQVIKKIMYHQL---CIDGNILKDS-E-VAEHLNLIRDNFNLS 276
gi 667631999 196 VVHDLFVFVEDFERVFYLSYALLHN-K-KFEVD--ILSKTIRMLLSYQA---LIMRKVNSG-----VEFGYKIQEEMDL- 262
gi 402468677 257 LIHDIFINLERVEWLVPFIYALLSTsV-YILDD--SFGLTVKQLLSHQM---EIDMSLCGDV-K-LKRFYLDIQKRLCLT 328
gi 523779729 241 LFHDILLYLEDPSKLLFFSYAIFYD-C-EIRCD--IISTTIKKILNYQL---NIDYKLYKEY-K---QFYNKIENSISLT 309
gi 817545645 203 IIHDLILYLQDFSKLVFYAFCIF-N-K-ELKSDlnILKMTLHMILSFQY---KIDLEIHKNK-KiIITSLNNLKSIFNF- 274
gi 269861131 245 ILFDIILLLKERTKLLYIISALFNN-VfGINNGnvIIVKTVISIIYHQY---LIEKDLYKNNaK-IIKYLNDIKTNFDLF 319
gi 906375061 118 ILHDIVLFSRDLDKYSTVYSILYSD---AIEKDgsEISDVLETIYYYSIaeeAID------------------------- 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621430  253 PRERSLKDACTSL--IGNFKVFE-----DRTFNSAIFP--NMYSVRVLCHYMDWDYTYNEFVRSVLYPRLKETRNPLYAV 323
gi 667640360 277 TPEISLWESLSHF--LVKHRLFDq---dRKIILADSIE--RGFCLRMLCHYIDWDYTYNTFILTQLYPKILSDKGAVHVY 349
gi 667631999 263 ------------------FDHFDvnslcNVILEDNSFShlNVASLRIICSFMDWNWTYNTFIVQMLYPRFVETNRPILLF 324
gi 402468677 329 ISSIDYICECKKL--IEKLDVFEs----DGNLNDKIFE--NGLRLKLICHYKDWDFAYNEIICNYIGPKLSETKDPAYLY 400
gi 523779729 310 ASSTDFIPYILSL--ESNFNINDe---------eSVIN--IAAVIRMITIFMDYDWAYNELIVNNIYPKYVSTKNIFYLV 376
gi 817545645 275 QKQVILEDYLLKI--KSDI---Eii--vKGKINPAIYE--YIYSVRALGHFLDWDYVYNIFISENLIQNITGCK----IL 341
gi 269861131 320 RYSENLFNLVNEFinIPIKKPIInf--kEGRIDNEFEI--VGWSIRTICHMLDWDYTYNTLILT----KLDYKNNPFHTL 391
gi 906375061 170 ----GLKSRCISI--LEKYATRTvf--iEERIVPEVFD--AVTSIRLYSKVLDWCWTYNEFIRDilypELKKSESAFAVL 239
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74621430  324 YMFVVAFNALRVFGDVESVNVVFDKLKEFM-----------SDASDLSIASYLFIKQIDPEGARKWYRSQIESIGHV 389
gi 667640360 350 YLGILMMNARRVFGYDESVERLEEELVSFL-----------EWKDECSVVAYMILKQVRQTDSESWMNENEEFLQNN 415
gi 667631999 325 YMGVICTLGYKNFGMHESVQSIFDEIKTCLd----------KDNVELSAIACSFVKNFDLDLAEKWGTRNKVKYGRQ 391
gi 402468677 401 YLGVLGINAYKSVGWHESVEKVFEAIQNMFe----------SNDVLLKITAFLFLKQIKYGFEQSWIEDNQSKILNM 467
gi 523779729 377 CIGTVALQGQRMFEDEKSVKNMYDFIKKEY-----------NE-------CNQNVKEIIKKYIARFEIIEKTEIENN 435
gi 817545645 342 YMGILALNSIRIFGETESADIIINFIKDKM-----------VEVDEIGIASFLVVKQLNEKDSLGFLEANEDNLMKK 407
gi 269861131 392 VTIYLTKDIFDSFGYENSVQLLCNEFISVM-----------NNDSEIAMLCYIFIKEINTKKAEEYTVLLKQMIIPE 457
gi 906375061 240 VLSAIYAEWNKSLSPHKSLEYVIQILDKVAgvgtgeeitpsMHSLEAQLASALMLRQFRPGASVKWHRKRIDEASDE 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap