Conserved Protein Domain Family
HTH_micro

?
pfam17007: HTH_micro 
HTH-like
This is a family of microsporidial sequences whose function is not known. It is possible that the proteins are DNA-binding as there is distant homology to helix-turn-helix families at the N-terminus.
Statistics
?
PSSM-Id: 319070
View PSSM: pfam17007
Aligned: 6 rows
Threshold Bit Score: 417.627
Threshold Setting Gi: 269860675
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621591   49 TADAVEGLKRN--FTTDCLRTETNRFMVENFSwsDLY-V--RMGSLAWKDYLTSGTFNFTSKEYFLIMSLLIEAR-RYVD 122
gi 440493832 113 STAEYGTVGKS--AGSSVQQLSPDDKYLLRLL--LVN-LyvRMNTVAWKEHLTNGSFNFTSKEYYYVFDMLIRMN-EYVS 186
gi 667641334  59 SPEQLDEFVSN--FTLSPFPSYVSKNIPENYI------I--RMNLQAWRAYLFGPNFITTNKFYFQMVDYIVTNP-DRAP 127
gi 484857729  39 DKNELDELENNieFVPSKKTDLND----------DLY-V--RMNFTYFKNLISDSRFKEISS--FKIFNHLLISG-DYVK 102
gi 300709260  39 YKADVSKIEND--FNGDTITKLKDYDTIIKDY--DLLnI--RIKFNIFKERLL--RYKFKEDYPYRVIDFLLKAD-GFVK 109
gi 269860675  48 TEAQVKDIQND--FMRSNLNKPEDLNSIEN--------I--RFNISYWTK-LTFGKTRPKNKEIYDIMNFIVQNKmRNVT 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621591  123 NVELR-KLNLDPKKTHYCINRLARKGFIEyKTSEEAQkknFIYKVRAivDergfvmrrvaEKQLLDTNRAD--------- 192
gi 440493832 187 VSNMRvTLGIEPKKMFYIIKKLVSLGYID-KTAEDNK---IVVKIRR--DesgnvvkgrpKEKRRSINSEDtitdtsvtn 260
gi 667641334 128 CSLLRsKFNIDPKTMHYLCKKLSERGIIE-EIKQGKE---TVIKLNK--V----------KDMSKQRNDEHpi------- 184
gi 484857729 103 QADLQhIGQVDTKKVSYVLKILRKSSFIKqKIIKNIS---YVkl---------------dVDSLFNRNKKq--------- 155
gi 300709260 110 SAEIReHLHLDSKKLFYVAKKLRCKEVLEqKRGNGAH---WLIKINK--D------------KLFENKGLEyt------- 165
gi 269860675 115 AKLIKaELNIEPKTISYALKLFKKHNLIKiIDKNIIK---YIFNYNS-----------------LEINANNnifndeiqy 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621591  193 -LPGKKRM---FEYRIDIGLYDNIREMILNSKDGIITEDLKNKLGVSSKIGYKLLNKIFNEEKDAVTRTEEFKGRIRRYR 268
gi 440493832 261 sFDEQHIG---MDILIGVPLITQIKKFIERSRTGVCSKDIQDRFGIKLKIGLKLLNKISDRMEGSIKTVEEFEGKIKRTK 337
gi 667641334 185 fSEEKSIDvskMVFYQNIPLIDQIKMHAKCRENGLGTKELNDITGISLKNALKHLQKLCEAHPDYFKMVNSIEHGHTTFK 264
gi 484857729 156 -YPLPIIP---REYFREVPIYYEIKRKLMNTEVGLTSSDIRRDYGVSVKRAHACLKKLEIEREKEIAIKQVFDGKTRKHL 231
gi 300709260 166 qYDSPFIP---IKFCTEIPILDQIKKLIGETYIGITTEDMQKQFGLSIRQSLHYLNKIIELNSNRYKWKEIFIGRVKRRL 242
gi 269860675 175 iLPKKIIN---YSYE------ELLKKDIYNTCEGITSIEIKNKYGLDVKQGLKDLIYLNNHNSNLYVSEYLLRYKSTVLA 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621591  269 YHvgTKSSEEAFQ------------EGGDGtRTVGYITSEERVRAIRKLMSTSPI-LQLDKRTYEKLQELTGWRYEFDRR 335
gi 440493832 338 FY--NVNELSKLKerkr-----qrmIAREQ-SVEEGITMEDRINAIEQILSVKKA-FVLDKEFFKDFRSILGCKYTLDRR 408
gi 667641334 265 VF--SIENLNKRNqrklkmmqktveIENDDpDVDPILTSKDRQEVLKIIAKKHGH-FILSKQIFEEISRMTGYPYNIDRK 341
gi 484857729 232 FY--KVENSELVD---------------DDlKEKGLITVNDRICALKQLLKDRKW-INTCEETFIKFRDILGSKYMPDRK 293
gi 300709260 243 FY--LVDNADAPNy--------------EEaETKKFITINDRIDALNQMLEEKRG-FVISEDTQKQFQHKMNYSYFPCKK 305
gi 269860675 246 FF--TKENHEKFNlikk-----hrlQKGNGlAEIQTITRNDKEYLIREELKKNKGiFVLNAENVEKLSAIAGVNYTFDKK 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621591  336 TIIKSAVLAGFKIYKQKRGKEgkcSRYMIMRNEMVESDiRALDVSN------C-DFQESMSEFQRKIYNIFVNSPKFVEM 408
gi 440493832 409 TVINAAIKGGFNVYKLHDDAQg--AKFVVARKDVLQDDpSVTNYYP------SrKTASTLTPFQSQLHKFFVTHSKFAEI 480
gi 667641334 342 NLISNAEAAGLKVFKLSDPPT---RRYVIALPHCDES--ILNQYVSahesipK-NESDEENKFYKSVKKYFMNISKCIIA 415
gi 484857729 294 TMISTAIKANLKVFNIRGTHSv--SSWLIANNDVQLSDiVQNKI----------KAAPKDNEFSKKVMSKYVKVPDFIAI 361
gi 300709260 306 TIMSTALKAGHKIYALMDTSE---RKTLIIHKDVDISS-YLNNNSN------E-KEIDFNNKLEKSFYHKFVLNEIFLPT 374
gi 269860675 319 NLLKIIKNMNVNILELNQTT----NKRIVYTNDYTEEE-VKNMFLN------K----EKVAKYLTILKYNIFSNKEIHAI 383
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 74621591  409 DNGYIPLREERLKLLYRFLvn--hmTSRGDES------LRFDWEVVREMEFNLLLSIVPFNRIGFRESL 469
gi 440493832 481 DNGFEPVLNKRVKALYSFL------RRLKENE------FYFNCDVLQSMSLGLFFKLVSFKRYKFLGEL 537
gi 667641334 416 DNGYCDNSDINIGILYEHIkeihrtNNSKKKSkvriipLFI---ILIRLPIVLLMSLI-FVLYSLIIKL 480
gi 484857729 362 DNLYKIKISNRFDIIFNFIy-----KNSKHEC------LQLSDEFLMNRSLLFLFNLVPFYKINFVKKL 419
gi 300709260 375 DNLFITDDRERITIFFDFLv-----KNSVNGY------TVISKELIYKMNLKLLFNVIPVEIPNILLKI 432
gi 269860675 384 DNLWQKDECERNKIFLTIL-------NTSENF------IQFTTLNILEMLLKDYLAIIKVSNIYFLEYL 439
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap