Conserved Protein Domain Family
DUF5094

?
pfam17015: DUF5094 
Domain of unknown function (DUF5094)
This family of largely microsporidial-specific proteins is of unknown function. However there may be distant homology to family Csm1, pfam12539.
Statistics
?
PSSM-Id: 319078
View PSSM: pfam17015
Aligned: 11 rows
Threshold Bit Score: 130.684
Threshold Setting Gi: 484856331
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621817    5 RK-RITFKTP-RK-GAKTP-------------------------MRDGGASDAKENRVQREGDIEKQKSPDSA------- 49
gi 440491928  78 RK-SDPVGGR-KKeAVKKRggarrgg------------kaamkdVHVDHDVDRDESSATSTKENSANTKNSKN------- 136
gi 523779881   5 RR-RLNFRTPtRK-KIERPnikltnikdknieskvnkketikknTKVSGGKSKKNEKVEKIENIKINKDSDMNiheddif 82
gi 667639772   6 KR-TLTFQTP-KKkAMTPLriaketa------------stssthFSDTERDNHMQPAITSTSNNIS-------------- 57
gi 269861969   1 MK-KGVSRTP-KK-QSRVVsksknrkkkenskeqenlqiqepahCEEKEINEKAHTKTVVMKEYMENETQQNG------- 70
gi 300702347   5 KK-RVTLKTP-KR-STKST-------------------------FKSTGHTKGVKDESDSVTKKKDSPSKFIA------- 49
gi 402468364 219 ntkkiaktsenKS-NLSKQqilenkystknnkhknkkfdhqenyDKVNYVETELKNICAQKDDSNTSEKQVLDikd--ei 295
gi 484857068  50 RK-RITLKTP-KR-STKTP-------------------------IKVFKP---------------------QP------- 73
gi 484856331  45 RK-RITLKTP-KR-STKTP-------------------------IKVFKP---------------------QP------- 68
gi 906375459   7 RRaAAHKRTPyKQ-RVHDVvnenplpn--------------------------------------------------snl 35
gi 378756237   7 RR-AAHKRTPyKQ-RTQEVpeqentlp-------------------------------------------------nsnl 35
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621817   50 SRYRQILVEMKMKEEDLIES-YKRENEYLRs------lKT-----DALLYKKLVGFDIVE-NNGCYEVTHEVVSnnitKS 116
gi 440491928 137 VDTRPSHKEILYIENELLQA-YREENAFLK--------TS-----VSSATSRLTGFTVTEpANDHFIVSYSAYD----RH 198
gi 523779881  83 SEYKDILYKIKDVQQELIEN-YIAENNHLRv------mKK-----DVLHYKKFIGWEIND-TEDGYQCTYDVEYkgtrKM 149
gi 667639772  58 ----------TSLENKLIEA-YREENSFLRn------lKS-----DVLLYTKLLGITIDQ-DGSFINFSIQRTSttgkKK 114
gi 269861969  71 V-MCSECRNYTDVKLELVTQ-LQEENRMLRe------eIQ-----HLLSTMNMLGITSHA-SGDTQVWGFHREGskgnIG 136
gi 300702347  50 ----DLDIEIKNTENELITS-LQKENELLRs---------------TNLYVKFLGLDITQ-VGDKYVVKYNVNKd--nRF 106
gi 402468364 296 DVYLQKITETRDIEKKYIKSiLSSQNET----------QN-----EQLFFQKFLGLKIQN-TGSTYKFIWNITDkeieKS 359
gi 484857068  74 SDITSLLKDLESHENKLLEK-YKKENLYLRs------lLNkgegnENTLSLSLLGLDIKE-INNEFIIKYKVEK----KY 141
gi 484856331  69 SDINSLLKDLESHENKLLEK-YKKENLYLRsllnkgevEG-----KDTSSLSLLGLDIKE-INNEFIIKYKVEK----KY 137
gi 906375459  36 idliKYYKEKEQIREEYITA-LKQENAYLRs-------NL-----AVPDQSSFTGLKISK-TGDIFNCKQTIEKegvtCS 101
gi 378756237  36 idliKYYKEKEEIREEYINA-LKAENTHLRn-------SL-----VVPDQSVFTGMTISR-VEDTLYCKQTIEKdgvvCS 101
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 74621817  117 IKFVLMPEDSSYIYKLVESRNV-DLPDFLSEEITFDECQIKTFFFKVMEAVITK 169
gi 440491928 199 INFRLVKNGRNYEYELIEHRCV-ELPEFLTDELVFGEEQLPKFFFNVMQVMVGK 251
gi 523779881 150 IKFLLIEEDDAYEYKLIENVNV-DLPEYLADDIWFGSQQLCEFFYSVMRAVLTK 202
gi 667639772 115 LGFTLEEAEQNYIFTLKESENC-NVPEYFYDVIEFDKKVFPQFFYKAMQAVYET 167
gi 269861969 137 LEFEIKDSGNNYTVQITSTHNC-DVPEYMYKGIEFKKKSFILFFYKLMQIICEN 189
gi 300702347 107 LHFELVPEDDMYVYSLVRSENI-DELGVLGDEISFEKEQIAKFFYKVMEIMISD 159
gi 402468364 360 IVFELKEDEEEYTYKLLEYKNV-VVSEAFMCIFSFEKNMLIRFMFNMYEILLSR 412
gi 484857068 142 LSFSLKPKDEFYIYKLKEHSEF-ELPNFLSEEISFEKQQVNKFFYKVMEIMIGN 194
gi 484856331 138 LSFSLKPKDEFYIYKLKEHSEF-ELPNFLSEEISFEKQQVNKFFYKVMEIMIGN 190
gi 906375459 102 ITFLLEEHEHIYVYTYKESKNVrDLPEYLQRTINFPKTQVKIFFFNIYQCVAKD 155
gi 378756237 102 LSFLLEEHEMIYTYIYQESRNIkDLPDYLQRTINFPKTQVKIFFFNIYQCVAKD 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap