Conserved Protein Domain Family
DUF5095

?
pfam17016: DUF5095 
Domain of unknown function (DUF5095)
This is a family of microsporidial-specific sequences. The function is not known and there is no distant homology to any Pfam families so far.
Statistics
?
PSSM-Id: 319079
View PSSM: pfam17016
Aligned: 9 rows
Threshold Bit Score: 196.803
Threshold Setting Gi: 300707983
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621432   43 SDNPFDVLs----------------qSLYRKSEASREEHQPNh-----------------------S------------- 70
gi 440491999  13 SDNPFRCT------------------NVVKKQKINPSEKIRT------------------------N------------- 37
gi 667640364 130 SENPFDIFn----------------gSLIKIEKPIEEPTKIAr-----------------------Q------------- 157
gi 523779874   6 PDNPKDILs----------------tTKPTIIKLSPKIKEKRe-----------------------F------------- 33
gi 484856184  29 TDDPFEIFf----------------dNYKENIEEILQPEDNNenvelldt---------kepksskS------------- 70
gi 906370716   2 KKNPFQ----------------------CKKQKENTLEGAIHe-----------------------Visgvkpepkkqtv 36
gi 169806272  23 DANPFNTT-------------------YLQVQNEKKSIKKAAk-----------------------S------------- 47
gi 378754441   2 KKNPFQ----------------------CKKQQETTIEKVIQgvlaeeceestdkntealdkteevS------------- 46
gi 300707983  26 PEDPFDIFyknsplsledvtlseldsSFIDEADTTKIISKPSqkdgesynh------itsplnkptQ------------- 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621432   71 ----------MVEDNIFEELLVKSRAEPAIEEEKIPY-G-IFTSMILMA-------D------MEIHAQDQRMYKFPFDP 125
gi 440491999  38 ----------QFNDDVFIKQLVKRDTSRKVTPKKCST-MnIYRKVKIVS-------K------NVLEGKRVEYFKFPFNT 93
gi 667640364 158 ----------KTTDEFILSGL-KRMRSQSNEFKNIRMtG-IFNKVTVVS-------K------TELSIDSKKYYKFPFDI 212
gi 523779874  34 ----------KINEKIFFEVLTKKEQKIKKERI---N-G-IFTSLEIFS-------F------EPLVEKNVKYYKFPFTH 85
gi 484856184  71 ----------KLTDNDFMNIL-KFTKIEKPLKKCNVF-G-ICQQLKILS-------N------NELDGFKITLYKFPFEM 124
gi 906370716  37 eplietiepvQIHEAEILKTLIDQKAKEKQGQMILSN-Y-IYNHIKLLT-------DektktdFETTMGSLLYYQTPETH 107
gi 169806272  48 ----------ILKLDILKKKIIKATTNNYTEKKS----N-ILENIQILS-------P------YELIKTTIDYFVFPHTQ 99
gi 378754441  47 ----------GVNETDVLKALQTHKKEQKILSEIPLN-Y-IYNYTRVVSadeeiknR------LEETVKNLLYYQVPESH 108
gi 300707983  87 ----------KISEDDFLSVLSKPKSVNSHKSFITPK---IINQLILYT-------S------DDIVQEAVPMYKFPYMP 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621432  126 ETRNDGSQLFEKMYSEYLIAIKSVFREYKRSNIR-----FYMKFKHEFLV-F-DSC--------------------LKVT 178
gi 440491999  94 NIKKDDSDLYNLVYMEWLLAITSVYKNYKNKNEE-----FYVKFFDKMFI-F-STA--------------------LYCS 146
gi 667640364 213 SVINDESAIFGTIKEEFVIAFSSAYSNYRKFGES-----FKILINEEVFN-F-SST--------------------VSCP 265
gi 523779874  86 IMKYEDNDLSQLIYQEYKKALIGAYNNLKNGNL------FYLLYNKELIV-F-NKK--------------------TILP 137
gi 484856184 125 NLKFDNSEIIKKIFLIFVSSLKDAFKKYKEEKKE-----FFVKFNCDFLH-F-GSE--------------------LKTT 177
gi 906370716 108 TIKKENSAAYARIFVNWREGLAGLFAEYRKANTKktefsFYA-YSDGIVHyF-HTNkcggcerpccanksgyslfiISDS 185
gi 169806272 100 ---FSTYNTVSSLYNYFPNALKAAFENYISFHKF-----FYVKLNDGLIK-F-ETK--------------------ICMT 149
gi 378754441 109 MFKKESSSVYNSIFVSWRQGLTELFSEYRRANTQgskfsFYV-YSDKLVYyF-HTSkyngcdkpcc-hkagyslyiSAKN 185
gi 300707983 141 DLRFEKSNIFKSIYTLFISSLLNIFKSKKD---------FIMKYKSDILI-YkNKE--------------------LKVS 190
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621432  179 SGMRKELARNEIEFEDEGSLLIIRGVEVALAFDYIVNASLSPSSCIPFILSESPFENGILFSVRLQR-KHAIRE---GKR 254
gi 440491999 147 SACKEILEQLEVEYLNEGSFLKVSGIDVALVYDYVINYEFKPKDKLPFILSKHKFTNSISYDSKFVE-NQLVRD---RGV 222
gi 667640364 266 ASCSKLLKSNDIKYTVENGIAKIDQDDTGLVYDVIMNLDIPKGKRAPFILSKFEFENGIVFRTKIQK-GPVIRN---KEC 341
gi 523779874 138 MKFKNLLENNDIIYREEKCGLVLEGREIALFFDVILNMKINYTQYIPFIISDVSFENSIAFKSQWVE-YPPVKC---KDK 213
gi 484856184 178 KGLKKILLANEINFTEEDEYIHIPFNEICLVVDLILNINLTVTSTIPFVLSKYPFENSMVYSVNMKK-IRTIKQ---EGK 253
gi 906370716 186 QNPKEL---YESEFIQNGAEWYLSGRGVLFILDTLLNTQASSVCALPLVISKYPFLNGILK----KP-SFSIRSenrSGK 257
gi 169806272 150 ENLVSLLKEHDILFIKENQDIIITDTP-NMVMDMLGNIKISNLATLPIIVSREQFEYSIYRIFRLNP-PKIIKI---NSK 224
gi 378754441 186 MKTTDILERFESNFVQSGDEFYLSGKEVLFILDTILNTQVSTIQSLPLVLSKYPFVNSILK----KP-TYTVRSenrSGK 260
gi 300707983 191 KGLIKLLNSNDIKY-EENDFLILKNIDIDLMIDLILNEPLSSTYVIPFIISRHKFINGMYYEVNLKKdKVAVKK---NNQ 266
                        330
                 ....*....|....*..
gi 74621432  255 ILYSYELLGPFWADDYK 271
gi 440491999 223 LKHYYVIEGYLYGHDFS 239
gi 667640364 342 IEYSYILVGPLDTSDFS 358
gi 523779874 214 IKYHYKIMGYLVGDDFK 230
gi 484856184 254 IYISYILNGPIWLEFCD 270
gi 906370716 258 KMYRIAIKGWTITSDIL 274
gi 169806272 225 QNYYYKTTGIVYLEDLS 241
gi 378754441 261 KAFRIIIKGWIITTDIA 277
gi 300707983 267 VLYKYILDGPFLNQDFI 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap